Recombinant Pig Fatty acid-binding protein, heart (FABP3)

Code CSB-EP007943PI
Abbreviation Recombinant Pig FABP3 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Fatty acid-binding protein 3 (Heart-type fatty acid-binding protein) (H-FABP)
Species
Sus scrofa (Pig)
Source
E.coli
Expression Region
2-133aa
Target Protein Sequence
VDAFAGTWKLVDSKNFDDYMKSIGVGFATRQVANMTKPTTIIEVNGDTIIIKTQSTFKSTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWNGQETTLVRELVDGKLILTLTHGSAVCTRTYEKEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis and C-terminal myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
13-23 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Gene References into Functions
  1. SNPs in the FABP3 promoter may contribute to intramuscular fat without influencing carcass fatness traits in pigs PMID: 25306509
  2. Expression of the FABP3 gene enhances adipogenesis in 3T3-L1 preadipocytes primarily by upregulating lipogenic genes. PMID: 24737696
  3. Results indicate that fatty acid binding protein H-FABP and CoA ligase 4 ACSL4 genes might serve as markers to improve fat (IMF) content in the breeding system. PMID: 25177956
  4. hFABP rises faster and correlates better with infarct size and no-reflow than hsTnI in myocardial infarction + reperfusion when measured early after reperfusion. PMID: 23873799
  5. Linkage disequilibrium analysis among MC4R, LEP and H-FABP revealed that these genes were independent. PMID: 22290286
  6. The FABP3 polymorphisms can be used as genetic markers in breeding programs for intramuscular fat content as well as carcass back fat thickness. PMID: 20848210
  7. The H-FABP MspI RFLP genotype affected unsaturated fatty acid content, and the ratio of polyunsaturated fatty acid to saturated fatty acid (P<0.05), whereas the H-FABP HaeIII RFLP genotype had no effect on fatty acid characteristics. PMID: 20659784
  8. The objective of this study was to investigate the effect of FABP3 and LEPR genetic variations as well as their mRNA expression on the intramuscular fat content trait in a three-generation of Korean native pig and Yorkshire crossed animals. PMID: 20300864
  9. Results of associated analysis show that the polymorphism of H-FABP gene was associated traits of Intramuscular fat content (IMF) and back fat thickness (BF). PMID: 16520310
  10. In our study FABP3 genotypes were confirmed to be significantly associated with intramuscular fat in pigs. PMID: 16706925
  11. Sirt1 regulates the expression of FABP3 gene in adipocytes, and PPAR gamma apparently plays an important role in this process. PMID: 19479941

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*