Recombinant Pig Leptin (LEP)

In Stock
Code CSB-EP012870PI
Abbreviation Recombinant Pig LEP protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Obesity factor
Species
Sus scrofa (Pig)
Source
E.coli
Expression Region
22-167aa
Target Protein Sequence
VPIWRVQDDTKTLIKTIVTRISDISHMQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARALETLESLGGVLEASLYSTEVVALSRLQGALQDMLRQLDLSPGC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal mFc2a-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pathways. In the hypothalamus, acts as an appetite-regulating factor that induces a decrease in food intake and an increase in energy consumption by inducing anorexinogenic factors and suppressing orexigenic neuropeptides, also regulates bone mass and secretion of hypothalamo-pituitary-adrenal hormones. In the periphery, increases basal metabolism, influences reproductive function, regulates pancreatic beta-cell function and insulin secretion, is pro-angiogenic for endothelial cell and affects innate and adaptive immunity. In the arcuate nucleus of the hypothalamus, activates by depolarization POMC neurons inducing FOS and SOCS3 expression to release anorexigenic peptides and inhibits by hyperpolarization NPY neurons inducing SOCS3 with a consequent reduction on release of orexigenic peptides. In addition to its known satiety inducing effect, has a modulatory role in nutrient absorption. In the intestine, reduces glucose absorption by enterocytes by activating PKC and leading to a sequential activation of p38, PI3K and ERK signaling pathways which exerts an inhibitory effect on glucose absorption. Acts as a growth factor on certain tissues, through the activation of different signaling pathways increases expression of genes involved in cell cycle regulation such as CCND1, via JAK2-STAT3 pathway, or VEGFA, via MAPK1/3 and PI3K-AKT1 pathways. May also play an apoptotic role via JAK2-STAT3 pathway and up-regulation of BIRC5 expression. Pro-angiogenic, has mitogenic activity on vascular endothelial cells and plays a role in matrix remodeling by regulating the expression of matrix metalloproteinases (MMPs) and tissue inhibitors of metalloproteinases (TIMPs). In innate immunity, modulates the activity and function of neutrophils by increasing chemotaxis and the secretion of oxygen radicals. Increases phagocytosis by macrophages and enhances secretion of pro-inflammatory mediators. Increases cytotoxic ability of NK cells. Plays a pro-inflammatory role, in synergy with IL1B, by inducing NOS2 wich promotes the production of IL6, IL8 and Prostaglandin E2, through a signaling pathway that involves JAK2, PI3K, MAP2K1/MEK1 and MAPK14/p38. In adaptive immunity, promotes the switch of memory T-cells towards T helper-1 cell immune responses. Increases CD4(+)CD25(-) T-cell proliferation and reduces autophagy during TCR (T-cell receptor) stimulation, through MTOR signaling pathway activation and BCL2 up-regulation.
Gene References into Functions
  1. study has allowed a transcriptional characterization of LEP and LEPR isoforms on a range of tissues. Their expression patterns seem to indicate that both molecules develop peripheral roles apart from their known hypothalamic signal transduction function PMID: 23824082
  2. The lack of effect of heat stress on the expression of leptin suggests that this peptide may not be involved in the reduction of feed intake of HS acclimated pigs. PMID: 27264891
  3. A high variability of the LEP was detected in the different analysed populations providing new data for the existence of two domestication centres in Asia. PMID: 25910874
  4. The presence of leptin and ObR-b varies across parities and is more intense in the uterus, ovaries and hypothalamus of females that were cycling before culling than in those having cystic ovaries. PMID: 25363738
  5. Studied 3'UTR leptin polymorphism regulatory sequences' affect on gene expression and their association with production traits. PMID: 25380469
  6. These results suggest that LEPR, MC4R, PIK3C3 and VRTN are useful markers for accurately predicting breeding values in Duroc pigs. PMID: 24128088
  7. Data showing changes in expression patterns of LEP/LEPR in endometrium/chorioallantoic membrane during placentation/fetal development suggest role for LEP/LEPR complex at early stages of pregnancy, possibly affecting the attachment process. PMID: 25245493
  8. Another funning discovery is ob-Rb mRNA in porcine endometrium was mainly negative-regulated by leptin PMID: 24407604
  9. Characterization of a distinctive pattern of periovulatory leptin secretion and its relationship with ovulation rate and luteal function in swine with obesity/leptin resistance PMID: 22841857
  10. Leptin and leptin receptor are expressed in porcine luteal cells, and there is a modulatory effect of LH, estradiol (E) and progesterone (P) on leptin mRNA expression as well as E and P on leptin secretion by those cells obtained in early pregnancy. PMID: 24101399
  11. The present study aimed to determine the effects of breed and sex on growth patterns and metabolic features of advanced-pregnancy foetuses from lean and obese/leptin resistant swine. PMID: 23935823
  12. Locally produced leptin plays a role in the regulation of porcine reproduction at the ovarian level and exerts a direct effect on follicles. Differences in long isoform of leptin receptor gene expression varies in the ovaries of pregnant and cyclic pigs. PMID: 23031202
  13. These results indicate that leptin and its receptors are expressed in porcine luteal cells and suggest that estradiol and progesterone affect leptin mRNA expression and leptin secretion during the mid-luteal phase of the estrous cycle. PMID: 23153703
  14. results suggest the T alleles of both LEP g.1387C>T and LEPR c.1987C>T, which are fixed in the Iberian pigs, would lead to an increase in growth, fatness and saturated fatty acid content in fat, which could be explained by an increased feed intake PMID: 22497241
  15. Linkage disequilibrium analysis among MC4R, LEP and H-FABP revealed that these genes were independent. PMID: 22290286
  16. role of transcription factor p53 and the metabolic hormone leptin, in controlling basic functions (proliferation, apoptosis and secretory activity) of ovarian cells PMID: 22151798
  17. The expression levels of leptin in the ovary during mid- and late-luteal phase of the oestrous cycle as well as during days 14-16 and 30-32 of pregnancy is reported. PMID: 19930136
  18. These results suggest that SNP G-2863A is a potential DNA marker for backfat thickness and has a regulatory role in leptin transcription. PMID: 20848213
  19. Increases in epicardial perivascular adipose tissue leptin exacerbate coronary endothelial dysfunction in MetS via a PKC-beta-dependent pathway. PMID: 20576943
  20. These results indicate that both leptin and OB-Rb are synthesized in the porcine hypothalamus and participate in control of reproduction during the oestrous cycle and early pregnancy. PMID: 19000220
  21. leptin enhances oocyte nuclear maturation via activation of the MAPK pathway. PMID: 15284194
  22. Leptin mRNA expression in the porcine hypothalamus and pituitary gland changes with time in pregnancy. PMID: 15349084
  23. The expression of leptin mRNA is higher in Large White pigs than that in Erhualian pigs. PMID: 15379252
  24. a transient increase in insulin during fasting is effective in restoring leptin concentrations; in addition, leptin levels in follicular fluid parallel those in plasma PMID: 15824969
  25. the role of leptin is to restrict the stage of corpora lutea formation PMID: 16177544
  26. LEP genotypes had significant influence on performance traits, and can be considered as potential genetic markers for selection. PMID: 17177692
  27. A 245 bp fragment of the porcine leptin gene promoter in the proximity of the transcription start site, is described. PMID: 17318373
  28. Leptin gene and protein expression in porcine endometrium, myometrium and trophoblast indicated that locally synthetized leptin can participate in control of pig reproduction. PMID: 17928651
  29. By sequencing LEP genes in 72 pigs belonging to lean (Large White and Duroc), fat (Meishan and Casertana) breeds and also Wild Boar, 98 polymorphic sites, of which 91 were novel, were found in the Leptin sequence. PMID: 18363978
  30. These data demonstrated that feed allowance level has important consequence on embryo survival, embryo development and uterine development, possibly mediated by changes in concentrations of reproductive hormones. PMID: 18700853
  31. polymorphisms in the leptin gene of 112 pigs and compare the maternal and paternal lineage of Pietrain and Large White breeds that underwent a divergent selection for over 30 years PMID: 19048501
  32. Therefore, our findings suggest a possible involvement of leptin in endocrine or autocrine/paracrine control of porcine male reproductive structures. PMID: 19306434
  33. This article describes the interaction between conjugated linoleic acids and leptin in the white adipose tissue of heavy pigs and hypothesized that there is an increased noradrenergic stimulation of lipolysis directly in the target tissue. PMID: 19710164

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Leptin family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*