Recombinant Pig Prolactin(PRL)

In Stock
Code CSB-EP018724PI
Product Type Recombinant Protein
Size US$2466
Uniprot No. P01238
Lead Time 3-7 business days
Relevance Prolactin acts primarily on the mammary gland by promoting lactation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Sus scrofa (Pig)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
Research Area Others
Source E.coli
Gene Names PRL
Expression Region 31-229aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 39.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Prolactin acts primarily on the mammary gland by promoting lactation.
Subcellular Location Secreted
Protein Families Somatotropin/prolactin family
Database Links

KEGG: ssc:396965

STRING: 9823.ENSSSCP00000001152

UniGene: Ssc.8204

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway

Q&A and Customer Reviews

Q&A
Q:

1. Can I use your Recombinant Pig Prolactin(PRL) in medium for canine cells?
2. I use human recombinant prolactin for cultured human cells but think that I have to replace with bovine or feline recombinant prolactine for canine cells as the homolofy is >95 with the bovine and feline and 79% with human. Yoru thoughts? this is a preclinical study. I will grow cells on scaffold and the construct will be implanted.
3. Also does the tagging have any effect?

A:
Thanks for your inquiry.
1.The analysis of 98% homology of canlf Growth hormone A1 (gene PRL) (32-230aa) and pig Prolactin (31-229) is theoretically possible.
2. Theoretically, the higher the homology, the greater the possibility of substitution;
3. Generally, the label has little impact on the experiment. If you are worried, we can also try to remove it, which is not guaranteed to be 100%.
We charge the fee of fusion protein plus enzyme cutting for successful label resection, but only the fee of fusion protein if it is not successful.
Customer Reviews

Related Products

PRL Antibodies

PRL Antibodies for Sus scrofa (Pig)

PRL Proteins

PRL Proteins for Sus scrofa (Pig)

PRL ELISA Kit

PRL ELISA Kit for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.