Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PRL

Uniprot No.

P01238

Research Area

Others

Alternative Names

PRL; Prolactin; PRL

Species

Sus scrofa (Pig)

Source

E.coli

Expression Region

31-229aa

Target Protein Sequence

LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

39.0kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The synthesis of Recombinant Pig PRL protein began with the isolation of PRL gene from the native genome. The next step was to amplify the PRL gene by inserting the PRL gene into an expression vector and then introducing the vector into the selected host cell, E.coli. Significant amounts of recombinant Pig PRL protein were produced by the host only when expression genes were added. For the purpose of protein purification, the vector contains N-terminal 6xHis-SUMO tag to the PRL DNA sequence. The purity of this protein is 90%+ determined by SDS-PAGE.

PRL is a gene encoding a protein named prolactin (PRL)(also known as lactotropin) in enabling mammals. The protein encoded by this gene can bind to prolactin receptor and has hormone activity s produced by the pituitary gland, a small gland at the base of the brain. It promotes lactation (breast milk production) in mammals and plays an essential role in metabolism, regulation of the immune system and pancreatic development.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

1. Can I use your Recombinant Pig Prolactin(PRL) in medium for canine cells?
2. I use human recombinant prolactin for cultured human cells but think that I have to replace with bovine or feline recombinant prolactine for canine cells as the homolofy is >95 with the bovine and feline and 79% with human. Yoru thoughts? this is a preclinical study. I will grow cells on scaffold and the construct will be implanted.
3. Also does the tagging have any effect?

Thanks for your inquiry.
1.The analysis of 98% homology of canlf Growth hormone A1 (gene PRL) (32-230aa) and pig Prolactin (31-229) is theoretically possible.
2. Theoretically, the higher the homology, the greater the possibility of substitution;
3. Generally, the label has little impact on the experiment. If you are worried, we can also try to remove it, which is not guaranteed to be 100%.
We charge the fee of fusion protein plus enzyme cutting for successful label resection, but only the fee of fusion protein if it is not successful.

Target Background

Function

Prolactin acts primarily on the mammary gland by promoting lactation.

Gene References into Functions

Prolactin and, to a lesser extent progesterone, which increase in early pregnancy, enhance basal and glucose-stimulated insulin secretion in part by increasing glucokinase activity and amplifying cAMP levels. PMID: 14559722
iv infusion of prolactin primarily caused coronary, mesenteric, renal, and iliac vasoconstriction PMID: 17463060
despite a lack of clear relationship between PRL/C499T polymorphism in 5' UTR of the PRL gene and plasma prolactin cioncentration, gene polymorphism impact on reproductiove performance cannot be excluded PMID: 19675522

Subcellular Location

Secreted.

Protein Families

Somatotropin/prolactin family

Database Links

KEGG: ssc:396965

STRING: 9823.ENSSSCP00000001152

UniGene: Ssc.8204

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address