Recombinant Pig Prolactin(PRL)

In Stock
Code CSB-EP018724PI
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names PRL
Uniprot No. P01238
Research Area Others
Alternative Names PRL; Prolactin; PRL
Species Sus scrofa (Pig)
Source E.coli
Expression Region 31-229aa
Target Protein Sequence LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 39.0kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Q&A and Customer Reviews

 Q&A
Q:

1. Can I use your Recombinant Pig Prolactin(PRL) in medium for canine cells?
2. I use human recombinant prolactin for cultured human cells but think that I have to replace with bovine or feline recombinant prolactine for canine cells as the homolofy is >95 with the bovine and feline and 79% with human. Yoru thoughts? this is a preclinical study. I will grow cells on scaffold and the construct will be implanted.
3. Also does the tagging have any effect?

A:
Thanks for your inquiry.
1.The analysis of 98% homology of canlf Growth hormone A1 (gene PRL) (32-230aa) and pig Prolactin (31-229) is theoretically possible.
2. Theoretically, the higher the homology, the greater the possibility of substitution;
3. Generally, the label has little impact on the experiment. If you are worried, we can also try to remove it, which is not guaranteed to be 100%.
We charge the fee of fusion protein plus enzyme cutting for successful label resection, but only the fee of fusion protein if it is not successful.

Target Data

Function Prolactin acts primarily on the mammary gland by promoting lactation.
Gene References into Functions
  1. Prolactin and, to a lesser extent progesterone, which increase in early pregnancy, enhance basal and glucose-stimulated insulin secretion in part by increasing glucokinase activity and amplifying cAMP levels. PMID: 14559722
  2. iv infusion of prolactin primarily caused coronary, mesenteric, renal, and iliac vasoconstriction PMID: 17463060
  3. despite a lack of clear relationship between PRL/C499T polymorphism in 5' UTR of the PRL gene and plasma prolactin cioncentration, gene polymorphism impact on reproductiove performance cannot be excluded PMID: 19675522
Subcellular Location Secreted
Protein Families Somatotropin/prolactin family
Database Links

KEGG: ssc:396965

STRING: 9823.ENSSSCP00000001152

UniGene: Ssc.8204

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1