Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Uniprot No.

Q91AV1

Research Area

Others

Alternative Names

E2;Peplomer protein

Species

Porcine epidemic diarrhea virus (strain CV777) (PEDV)

Source

E.coli

Expression Region

19-278aa

Target Protein Sequence

LPQDVTRCQSTTNFRRFFSKFNVQAPAVVVLGGYLPSMNSSSWYCGTGIETASGVHGIFLSYIDSGQGFEIGISQEPFDPSGYQLYLHKATNGNTNAIARLRICQFPDNKTLGPTVNDVTTGRNCLFNKAIPAYMRDGKDIVVGITWDNDRVTVFADKIYHFYLKNDWSRVATRCYNRRSCAMQYVYTPTYYMLNVTSAGEDGIYYEPCTANCTGYAANVFATDSNGHIPEGFSFNNWFLLSNDSTLLHGKVVSNQPLLV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

35.9 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Datasheet & COA

Please contact us to get it.

Target Background

Function

S1 region attaches the virion to the cell membrane by interacting with host ANPEP/aminopeptidase N, initiating the infection. Binding to the receptor probably induces conformational changes in the S glycoprotein unmasking the fusion peptide of S2 region and activating membranes fusion. S2 region belongs to the class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.

Gene References into Functions

Collectively, the data demonstrate that the S1 subunit of the S protein is an important determinant of porcine epidemic diarrhea virus virulence. PMID: 30200258
Molecular characteristics of the spike gene of porcine epidemic diarrhoea virus strains in Eastern China in 2016 have been reported. PMID: 29412159
Evolutionary and epidemiological analyses based on spike genes of porcine epidemic diarrhea virus circulating in Thailand in 2008-2015 has been presented. PMID: 28235643
Large Deletions in the Spike Gene is associated with coronavirus infections in swine. PMID: 28095455
Epitopes of neutralizing antibodies mapped to two distinct domains in S1 that are involved in binding to carbohydrate and proteinaceous cell surface molecules, respectively, indicating the importance of these cell attachment sites on the Porcine epidemic diarrhea virus spike protein in eliciting a protective humoral immune response. PMID: 28381581
Together these results indicate that the S2 glycoprotein subunit contains major antigenic determinants and, perhaps, the immunodominant neutralizing epitopes of porcine epidemic diarrhea virus. PMID: 28647506
The C-terminal domain of the S1 domain of porcine epidemic diarrhea virus is bound to swine pAPN. PMID: 26907329
Based on S gene, all of the PEDV strains from pigs in mid-eastern China could be assigned to 3 genogroups. PMID: 25673903
A large deletion in the spike gene identified in domestic pigs. PMID: 26162305
Point mutation of the furin cleavage site at the S2' position of the S protein enables the virus to infect cultured cells independently of trypsin. PMID: 25972540
S1 domain of the porcine epidemic diarrhea virus spike protein is highly immunogenic and protective. PMID: 25008896
H1381R mutation in the cytoplasmic retrieval signal of S protein is responsible for enhanced fusion activity. PMID: 21840351
Receptor-bound spike protein cleaved by trypsin induces membrane fusion. PMID: 21667287
The spike (S) gene of the attenuated porcine epidemic diarrhea virus (PEDV) DR13 was cloned and sequenced. PMID: 17072758
Partial S glycoprotein genes including epitope regions of Korean PEDV isolates have been determined and compared to each other as well as to reference PEDV strains, to find genetic diversity of PEDV in S glycoprotein genes. PMID: 17436070
A synthetic peptide whose linear sequence is identical to the 24a.a. carboxy-terminal portion of the spike protein (S-CT24) elicited a strong antibody response in BALB/c mice. PMID: 18067984

Hide All

Subcellular Location

Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein.

Protein Families

Alphacoronaviruses spike protein family

Database Links

KEGG: vg:935184

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP849611PPW
Abbreviation	Recombinant Porcine epidemic diarrhea virus S protein, partial
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Porcine epidemic diarrhea virus Spike glycoprotein (S), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage