Recombinant Porcine epidemic diarrhea virus Spike glycoprotein (S), partial

In Stock
Code CSB-EP849611PPW
Abbreviation Recombinant Porcine epidemic diarrhea virus S protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
S
Uniprot No.
Research Area
Others
Alternative Names
E2;Peplomer protein
Species
Porcine epidemic diarrhea virus (strain CV777) (PEDV)
Source
E.coli
Expression Region
19-278aa
Target Protein Sequence
LPQDVTRCQSTTNFRRFFSKFNVQAPAVVVLGGYLPSMNSSSWYCGTGIETASGVHGIFLSYIDSGQGFEIGISQEPFDPSGYQLYLHKATNGNTNAIARLRICQFPDNKTLGPTVNDVTTGRNCLFNKAIPAYMRDGKDIVVGITWDNDRVTVFADKIYHFYLKNDWSRVATRCYNRRSCAMQYVYTPTYYMLNVTSAGEDGIYYEPCTANCTGYAANVFATDSNGHIPEGFSFNNWFLLSNDSTLLHGKVVSNQPLLV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.9 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
S1 region attaches the virion to the cell membrane by interacting with host ANPEP/aminopeptidase N, initiating the infection. Binding to the receptor probably induces conformational changes in the S glycoprotein unmasking the fusion peptide of S2 region and activating membranes fusion. S2 region belongs to the class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes.
Gene References into Functions
  1. Collectively, the data demonstrate that the S1 subunit of the S protein is an important determinant of porcine epidemic diarrhea virus virulence. PMID: 30200258
  2. Molecular characteristics of the spike gene of porcine epidemic diarrhoea virus strains in Eastern China in 2016 have been reported. PMID: 29412159
  3. Evolutionary and epidemiological analyses based on spike genes of porcine epidemic diarrhea virus circulating in Thailand in 2008-2015 has been presented. PMID: 28235643
  4. Large Deletions in the Spike Gene is associated with coronavirus infections in swine. PMID: 28095455
  5. Epitopes of neutralizing antibodies mapped to two distinct domains in S1 that are involved in binding to carbohydrate and proteinaceous cell surface molecules, respectively, indicating the importance of these cell attachment sites on the Porcine epidemic diarrhea virus spike protein in eliciting a protective humoral immune response. PMID: 28381581
  6. Together these results indicate that the S2 glycoprotein subunit contains major antigenic determinants and, perhaps, the immunodominant neutralizing epitopes of porcine epidemic diarrhea virus. PMID: 28647506
  7. The C-terminal domain of the S1 domain of porcine epidemic diarrhea virus is bound to swine pAPN. PMID: 26907329
  8. Based on S gene, all of the PEDV strains from pigs in mid-eastern China could be assigned to 3 genogroups. PMID: 25673903
  9. A large deletion in the spike gene identified in domestic pigs. PMID: 26162305
  10. Point mutation of the furin cleavage site at the S2' position of the S protein enables the virus to infect cultured cells independently of trypsin. PMID: 25972540
  11. S1 domain of the porcine epidemic diarrhea virus spike protein is highly immunogenic and protective. PMID: 25008896
  12. H1381R mutation in the cytoplasmic retrieval signal of S protein is responsible for enhanced fusion activity. PMID: 21840351
  13. Receptor-bound spike protein cleaved by trypsin induces membrane fusion. PMID: 21667287
  14. The spike (S) gene of the attenuated porcine epidemic diarrhea virus (PEDV) DR13 was cloned and sequenced. PMID: 17072758
  15. Partial S glycoprotein genes including epitope regions of Korean PEDV isolates have been determined and compared to each other as well as to reference PEDV strains, to find genetic diversity of PEDV in S glycoprotein genes. PMID: 17436070
  16. A synthetic peptide whose linear sequence is identical to the 24a.a. carboxy-terminal portion of the spike protein (S-CT24) elicited a strong antibody response in BALB/c mice. PMID: 18067984

Show More

Hide All

Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein.
Protein Families
Alphacoronaviruses spike protein family
Database Links

KEGG: vg:935184

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*