Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP001936RBb7 |
| Size |
US$2466Purchase it in Cusabio online store (only available for customers from the US) |
| Image |
|
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | APOE |
| Uniprot No. | P18287 |
| Research Area | Cardiovascular |
| Species | Oryctolagus cuniculus (Rabbit) |
| Source | E.coli |
| Expression Region | 20-311aa |
| Target Protein Sequence | TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 50.6kDa |
| Protein Length | Partial |
| Tag Info | N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| Datasheet & COA | Please contact us to get it. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. |
| Subcellular Location | Secreted |
| Protein Families | Apolipoprotein A1/A4/E family |
| Tissue Specificity | Secreted in plasma. |
| Database Links |
KEGG: ocu:100009337 UniGene: Ocu.6224 |
Recombinant Human Schlafen family member 12(SLFN12)
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha(FCER1A),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Dog Caveolin-1(CAV1)
Express system: Yeast
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Mouse Lysyl oxidase homolog 2(Loxl2)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Thyroid peroxidase(TPO),partial
Express system: Yeast
Species: Homo sapiens (Human)
