Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP001936RBb7 |
| Product Type | Recombinant Protein |
| Size |
US$298Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | P18287 |
| Lead Time | 3-7 business days |
| Relevance | Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Oryctolagus cuniculus (Rabbit) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ |
| Research Area | Cardiovascular |
| Source | E.coli |
| Gene Names | APOE |
| Expression Region | 20-311aa |
| Tag Info | N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged |
| Mol. Weight | 50.6kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. |
| Subcellular Location | Secreted |
| Protein Families | Apolipoprotein A1/A4/E family |
| Tissue Specificity | Secreted in plasma. |
| Database Links |
KEGG: ocu:100009337 UniGene: Ocu.6224 |
| Pathway | Cholesterol metabolism |
APOE Proteins for Oryctolagus cuniculus (Rabbit)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP001936RB CSB-BP001936RB CSB-MP001936RB |
Recombinant Rabbit Apolipoprotein E(APOE) | Yeast Baculovirus Mammalian cell |
| CSB-EP001936RBb3 | Recombinant Rabbit Apolipoprotein E(APOE),partial | E.coli |
| CSB-EP001936RB | Recombinant Rabbit Apolipoprotein E(APOE),partial | E.coli |
APOE ELISA Kit for Oryctolagus cuniculus (Rabbit)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E09806Rb | Rabbit apolipoprotein E (Apo-E) ELISA Kit | serum, plasma, tissue homogenates | 3.9 ng/mL |
Recombinant Rat Frataxin, mitochondrial(Fxn)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Staphylococcus aureus Acyl carrier protein(acpP)
Express system: Yeast
Species: Staphylococcus aureus (strain Mu50 / ATCC 700699)
Recombinant Human Integrin alpha-2(ITGA2),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha(IL1A)
Express system: E.coli
Species: Macaca mulatta (Rhesus macaque)
Recombinant Human Vascular endothelial growth factor B(VEGFB)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Rat Thyrotropin subunit beta(Tshb)
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Mouse Collagen alpha-2(IV) chain(Col4a2),partial
Express system: Yeast
Species: Mus musculus (Mouse)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
