Recombinant Rabbit Integrin beta-8(ITGB8),partial

In Stock
Code CSB-EP011892RB
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P26013
Lead Time 3-7 business days
Relevance Integrin alpha-V/beta-8 is a receptor for fibronectin.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Oryctolagus cuniculus (Rabbit)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL
Research Area Signal Transduction
Source E.coli
Gene Names ITGB8
Protein Names Recommended name: Integrin beta-8
Expression Region 146-384aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 31.9kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Integrin alpha-V/beta-8 is a receptor for fibronectin.
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Integrin beta chain family
Tissue Specificity Placenta, kidney, brain, ovary, uterus and in several transformed cells.
Database Links

KEGG: ocu:100009141

STRING: 9986.ENSOCUP00000001898

UniGene: Ocu.1889

Pathway PI3K-Akt signaling pathway
Focal adhesion
Regulation of actin cytoskeleton

Related Products

ITGB8 Proteins

ITGB8 Proteins for Oryctolagus cuniculus (Rabbit)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.