Recombinant Rabbit Integrin beta-8(ITGB8)

Code CSB-CF011892RB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P26013
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Oryctolagus cuniculus (Rabbit)
Sequence ENSRCASSHAVSCSECLALGPDCGWCVHEDFISGGPRSERCDIVSNLISKGCPVDSIEYPSVHVTIPSENEVNTQVTPGEVSIQLRPGAAANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQVESKVPGVYFNVTAICPDGARKLGMEGCSNVTSSDEVLFNVTVTMEKCSVTGGKNYAIIKPIGFNETSKIHIHQNCGCECEASRGGAAKCAEEAPLDSTCPQCQESQCHQEEAQSPSQGCKAHEDQPVCSGRGVCVCGKCLCHKMKLGKVYGKYCEKDDFSCPYHHGSLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECSDPRSIGRFCEHCPTCPTACSENWNCVQCLHPHNLSQAILDQCRTSCASMEQPYVEQASECFSSPSYLRIFFIIFIVTFLIGLLKILIIRQVILQWNSSKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKPEEIKLDISKLNAHETFRCNF
Source in vitro E.coli expression system
Gene Names ITGB8
Protein Names Recommended name: Integrin beta-8
Expression Region 43-768
Tag Info 10xHis-SUMO-tag
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Integrin alpha-V/beta-8 is a receptor for fibronectin.
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Integrin beta chain family
Tissue Specificity Placenta, kidney, brain, ovary, uterus and in several transformed cells.
Database Links

KEGG: ocu:100009141

STRING: 9986.ENSOCUP00000001898

UniGene: Ocu.1889

Pathway PI3K-Akt signaling pathway
Focal adhesion
Regulation of actin cytoskeleton

Related Products

ITGB8 Proteins

ITGB8 Proteins for Oryctolagus cuniculus (Rabbit)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.