Home
Protein
Recombinant Proteins
Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial

Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial

^{In Stock}

Code	CSB-MP023994RB1
Abbreviation	Recombinant Rabbit TNFSF4 protein, partial
MSDS	MSDS Datasheet
Size	$660
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

TNFSF4

Uniprot No.

O02765

Research Area

Immunology

Alternative Names

TNFSF4; TXGP1; Tumor necrosis factor ligand superfamily member 4; OX40 ligand; OX40L; CD antigen CD252

Species

Oryctolagus cuniculus (Rabbit)

Source

Mammalian cell

Expression Region

45-187aa

Target Protein Sequence

QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

44.9 kDa

Protein Length

Partial

Tag Info

C-terminal hFc1-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

In the process of expressing the recombinant Rabbit TNFSF4 protein, mammalian cells are transfected with a DNA expression vector that carries the gene encoding the desired protein (45-187aa). The cells are then cultured to induce the expression of the intended protein. The protein features a C-terminal hFc tag fusion. The recombinant Rabbit TNFSF4 protein is collected and purified from the cell lysate through affinity purification, with its purity surpassing 90%, as assessed by SDS-PAGE.