Recombinant Rat Serine protease 1 (Prss1)

In Stock
Code CSB-YP018811RA
Abbreviation Recombinant Rat Prss1 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Prss1
Uniprot No.
Research Area
Others
Alternative Names
Prss1; Try1; Anionic trypsin-1; EC 3.4.21.4; Anionic trypsin I; Pretrypsinogen I; Serine protease 1
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
24–246aa
Target Protein Sequence
IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Serine protease 1 (Prss1) is produced in a yeast expression system, covering amino acids 24 to 246 of the mature protein. The protein carries an N-terminal 6xHis tag, which helps with purification and detection. It reaches a purity greater than 90% as determined by SDS-PAGE, suggesting high-quality research applications. This product is designed for research use only.

Serine protease 1, also known as Prss1, appears to be a critical enzyme in the digestive system, involved in breaking down peptide bonds. It likely plays a vital role in various biological pathways, including protein digestion and absorption. Given its importance in proteolytic processes, Prss1 has become a significant focus in research related to enzymatic activity and regulation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Enzyme Kinetics and Biochemical Characterization Studies

This recombinant rat Prss1 can help investigate the fundamental enzymatic properties of serine protease 1. Researchers might examine substrate specificity, kinetic parameters (Km, Vmax), and optimal reaction conditions. The high purity (>90%) and full-length mature protein structure seem well-suited for detailed biochemical analysis using various protease substrates and inhibitors. Scientists can establish baseline enzymatic activity profiles and compare catalytic efficiency across different experimental conditions.

2. Protein-Protein Interaction Studies

The N-terminal 6xHis tag allows for purification and immobilization when studying protein-protein interactions involving rat Prss1. Pull-down assays may be performed to identify potential binding partners or substrates from rat tissue lysates or recombinant protein libraries. The tag also makes it easier to use surface plasmon resonance or other biophysical techniques to quantify binding kinetics and affinities with known or suspected interaction partners.

3. Antibody Development and Validation

This purified recombinant protein serves as an ideal antigen for generating specific antibodies against rat Prss1 in immunization protocols. The high purity should minimize cross-reactivity with other proteins during antibody production. The recombinant protein can also be used as a positive control and standard for validating antibody specificity in Western blotting, ELISA, and immunohistochemistry applications targeting endogenous rat Prss1.

4. Protease Inhibitor Screening and Development

The recombinant rat Prss1 provides a standardized enzyme source for screening potential protease inhibitors in drug discovery research. High-throughput assays may be developed to test libraries of small molecules or peptide inhibitors for their ability to modulate Prss1 activity. The consistent protein quality and His-tag purification allow for reproducible assay conditions when conducting structure-activity relationship studies of inhibitor compounds.

5. Comparative Proteomics and Species-Specific Studies

This rat-specific Prss1 makes possible comparative studies with related serine proteases from other species to understand evolutionary relationships and functional differences. The recombinant protein can be used alongside human or mouse variants to investigate species-specific substrate preferences, inhibitor sensitivities, or structural features. Such comparative analyses may provide insights into the conservation and divergence of serine protease function across mammalian species.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Could you provide additional details to the following questions:
Does the componoud contain any salts?
Does the product contain any narcotic, toxic, hazardous substances or require any caution for handling?Does the product require freezing to ship?
What form of the product do you have in stock? If this item is dissolved in a solvent, could you let us know its solvent and concentration?
Does the product have a strong smell?

A:

The componoud contain salts, the buffer information of this protein is Lyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 10mM CaCl2, 6% Trehalose,pH 8.0. It doesn't contain any narcotic, toxic, hazardous substances. We usually ship with ice packs. Both lyophlized format and liquid format are available. It doesn't have a strong smell.

Target Background

Gene References into Functions
  1. ectopic anionic trypsin I in rat lungs induced by virus infection may trigger virus spread in rat lungs PMID: 12027901
Subcellular Location
Secreted, extracellular space.
Protein Families
Peptidase S1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*