Recombinant Rat Serine protease 1 (Prss1)

In Stock
Code CSB-YP018811RA
Abbreviation Recombinant Rat Prss1 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Prss1
Uniprot No.
Research Area
Others
Alternative Names
Prss1; Try1; Anionic trypsin-1; EC 3.4.21.4; Anionic trypsin I; Pretrypsinogen I; Serine protease 1
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
24–246aa
Target Protein Sequence
IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Serine protease 1 (Prss1) is produced in a yeast expression system, covering amino acids 24 to 246 of the mature protein. The protein carries an N-terminal 6xHis tag, which helps with purification and detection. It reaches a purity greater than 90% as determined by SDS-PAGE, suggesting high-quality research applications. This product is designed for research use only.

Serine protease 1, also known as Prss1, appears to be a critical enzyme in the digestive system, involved in breaking down peptide bonds. It likely plays a vital role in various biological pathways, including protein digestion and absorption. Given its importance in proteolytic processes, Prss1 has become a significant focus in research related to enzymatic activity and regulation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant rat Prss1 is produced in a yeast expression system as the full-length mature protein (24-246aa) with an N-terminal 6xHis-tag. Yeast expression systems provide eukaryotic folding machinery capable of supporting disulfide bond formation and some post-translational modifications, which are critical for serine protease activity and stability. Prss1 typically requires proper folding, activation (e.g., cleavage of a propeptide), and formation of a functional active site for enzymatic activity. The N-terminal 6xHis tag may interfere with the protein's native structure or activation process, as the N-terminus is often important for protease function. No validation data (e.g., enzymatic activity assays, circular dichroism) are provided. Therefore, while yeast expression increases the probability of correct folding compared to prokaryotic systems, the protein's folding status and bioactivity cannot be confirmed without experimental validation.

1. Enzyme Kinetics and Biochemical Characterization Studies

Serine protease activity depends on precise folding and active site formation; misfolding renders kinetic data biologically irrelevant. If the recombinant Prss1 is correctly folded and active, it can be used for enzyme kinetics studies to determine parameters like Km and Vmax using synthetic substrates. However, if misfolded or inactive (due to the His-tag interfering with activation or active site formation), kinetic assays would yield invalid results. The high purity supports reproducibility, but cannot compensate for the lack of activity.

2. Protein-Protein Interaction Studies

Protein-protein interactions require native conformation; misfolding compromises binding specificity. If properly folded, the His-tagged Prss1 could be used in pull-down assays to identify interaction partners, such as inhibitors or substrates. However, if misfolded, interaction domains may be altered, leading to non-specific binding or failure to recognize genuine biological partners. The tag may also sterically hinder some interactions.

3. Antibody Development and Validation

Antibodies can be produced against linear sequences, but conformational epitopes may be misrepresented if the protein is misfolded. This application is suitable as antibody generation primarily relies on linear epitope recognition, which is independent of folding status. The high purity and full-length sequence ensure comprehensive epitope coverage. However, if misfolded, antibodies may not optimally recognize conformational epitopes of native Prss1 in biological contexts.

4. Protease Inhibitor Screening and Development

Inhibitor screening requires a functional enzyme; misfolding invalidates high-throughput assays. If the recombinant Prss1 is active, it can be used for inhibitor screening in drug discovery. However, if inactive, screening would yield false negatives or invalid structure-activity relationships. The His-tag may also affect inhibitor binding if it alters the active site.

5. Comparative Proteomics and Species-Specific Studies

Comparative studies require native activity and structure; misfolding leads to erroneous evolutionary insights. If correctly folded and functional, the recombinant Prss1 enables valid comparative studies with orthologs from other species. However, if misfolded, any comparative data on substrate preference or inhibitor sensitivity would be misleading and not reflect biological differences.

Final Recommendation & Action Plan

Before employing this recombinant Prss1 in any functional application, it is essential to validate its folding and bioactivity through enzymatic assays (e.g., using fluorogenic substrates to confirm protease activity) and biophysical characterization (e.g., circular dichroism for secondary structure). If validation confirms activity, proceed with applications while considering the potential impact of the His-tag on function; if inactive, consider using tag-free protein or a different expression system (e.g., mammalian cells for proper activation). For immediate use, antibody development can proceed with the understanding that antibodies may require validation against native protein. Avoid kinetic, inhibitor screening, and comparative studies until bioactivity is confirmed. Always include appropriate controls (e.g., active protease standards) in experiments.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Could you provide additional details to the following questions:
Does the componoud contain any salts?
Does the product contain any narcotic, toxic, hazardous substances or require any caution for handling?Does the product require freezing to ship?
What form of the product do you have in stock? If this item is dissolved in a solvent, could you let us know its solvent and concentration?
Does the product have a strong smell?

A:

The componoud contain salts, the buffer information of this protein is Lyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 10mM CaCl2, 6% Trehalose,pH 8.0. It doesn't contain any narcotic, toxic, hazardous substances. We usually ship with ice packs. Both lyophlized format and liquid format are available. It doesn't have a strong smell.

Target Background

Gene References into Functions
  1. ectopic anionic trypsin I in rat lungs induced by virus infection may trigger virus spread in rat lungs PMID: 12027901
Subcellular Location
Secreted, extracellular space.
Protein Families
Peptidase S1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*