Recombinant Rat Anionic trypsin-1(Prss1)

In Stock
Code CSB-EP018811RAb0
Product Type Recombinant Protein
Size US$2466
Uniprot No. P00762
Lead Time 3-7 business days
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
Research Area Metabolism
Source E.coli
Gene Names Prss1
Expression Region 24-246aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 27.2 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Secreted, extracellular space
Protein Families Peptidase S1 family
Database Links

KEGG: rno:24691

STRING: 10116.ENSRNOP00000043068

UniGene: Rn.34435

Related Products

Prss1 Antibodies

Prss1 Antibodies for Rattus norvegicus (Rat)

Prss1 Proteins

Prss1 Proteins for Rattus norvegicus (Rat)

Prss1 ELISA Kit

Prss1 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.