Recombinant Rat Anionic trypsin-1(Prss1)

Code CSB-EP018811RA
Product Type Recombinant Protein
Size US$2466
Uniprot No. P00762
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP018811RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Prss1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP018811RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Prss1.
Storage Buffer Tris-based buffer,50% glycerol
Alias Anionic trypsin IPretrypsinogen ISerine protease 1
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
Research Area Others
Source E.coli
Gene Names Prss1
Protein Names Recommended name: Anionic trypsin-1 EC= 3.4.21.4 Alternative name(s): Anionic trypsin I Pretrypsinogen I Serine protease 1
Expression Region 24-246aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 39.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Secreted, extracellular space
Protein Families Peptidase S1 family
Database Links

KEGG: rno:24691

STRING: 10116.ENSRNOP00000043068

UniGene: Rn.34435

Related Products

Prss1 Antibodies

Prss1 Antibodies for Rattus norvegicus (Rat)

Prss1 Proteins

Prss1 Proteins for Rattus norvegicus (Rat)

Prss1 ELISA Kit

Prss1 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.