Name: Recombinant Rat Anionic trypsin-2 (Prss2)
Brand: CUSABIO
SKU: 018814RA

Product Details

Purity

>85% (SDS-PAGE)

Target Names

Prss2

Uniprot No.

P00763

Alternative Names

Prss2; Try2; Anionic trypsin-2; EC 3.4.21.4; Anionic trypsin II; Pretrypsinogen II; Serine protease 2

Species

Rattus norvegicus (Rat)

Expression Region

Protein Length

Full Length of Mature Protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I have a question regarding Recombinant Rat Anionic trypsin-2(Prss2) # CSB-EP018814RA, CSB-YP018814RA that we purchased for research use.
Could you provide us the amino acid sequence of this product?
Is this protein active or proform?

Very nice to receive your inquiry. Recombinant Rat Anionic trypsin-2(Prss2) # CSB-EP018814RA, CSB-YP018814RA
Pls check the product information as follows:
Expression Region: 24-246aa; Full length of the mature protein.
Tag information: EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged; YP: N-terminal 6xHis-tagged
Target protein Sequence:(Not include the tag sequence)

IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN

Regarding the activity, sorry, we haven't tested the activity of these proteins for the time being, however, as what we provide is the full length of the mature protein,
and they are purified under very mild environment, in theory, it should be active. We recommend you to purchase a small size to have a try.
If you don't know how to choose the most suitable expression system to express the protein, Pls refer to this information "Which expression system suits your experiment most ?" on our website.
https://www.cusabio.com/protein_service/
Or you can tell us your application, we can analyze for you and recommend the most suitable product to you.

Target Background

Gene References into Functions

activated microglia increase neurogenesis through secretion of PRSS2. PMID: 23650361
Nicotine impairs secretion rather than production of pancreatic trypsinogen 2. PMID: 18815551

Subcellular Location

Secreted, extracellular space.

Protein Families

Peptidase S1 family

Database Links

KEGG: rno:25052

STRING: 10116.ENSRNOP00000060784

UniGene: Rn.1584

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP018814RA
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP018814RA-B
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Conjugate	Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-BP018814RA
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Baculovirus
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-MP018814RA
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Mammalian cell
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Anionic trypsin-2 (Prss2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage