Recombinant Rat Complement factor D(Cfd)

In Stock
Code CSB-YP005271RA
Product Type Recombinant Protein
Size US$2474
Uniprot No. P32038
Lead Time 3-7 business days
Relevance Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA
Research Area Immunology
Source Yeast
Gene Names Cfd
Protein Names Recommended name: Complement factor D EC= 3.4.21.46 Alternative name(s): Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D
Expression Region 26-263aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 27.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
Subcellular Location Secreted
Protein Families Peptidase S1 family
Database Links

KEGG: rno:54249

STRING: 10116.ENSRNOP00000015029

UniGene: Rn.16172

Pathway Complement and coagulation cascades

Related Products

Cfd Antibodies

Cfd Antibodies for Rattus norvegicus (Rat)

Cfd Proteins

Cfd Proteins for Rattus norvegicus (Rat)

Cfd ELISA Kit

Cfd ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.