All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
  • Peptide
All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
  • Peptide

Recombinant Rat Gastrin (Gast)

Code CSB-EP009273RA
Abbreviation Recombinant Rat Gast protein
MSDS
MSDS Datasheet
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Gast
Uniprot No.
P04563
Research Area
Others
Alternative Names
Gast;Gas
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
22-104aa
Target Protein Sequence
SWKPRSQLQDASSGPRTNGALEQHQLEKLGPASHHRRQLGPQGPQHFIADLSKKQRPPMEEEEEAYGWMDFGRRSAEEEDQYN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Protein FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Related Products

Gast Proteins

Gast ELISA kits

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
Gene References into Functions
  1. we examined the chronic effects of a GLP-1-gastrin dual agonist ZP3022 on glycemic control and beta cell dysfunction in overtly diabetic Zucker Diabetic Fatty PMID: 25849341
  2. treatment with gastrin, a CCK2R agonist, stimulated the secretion of GLP-1, and that this effect was likely due to increased expression of proglucagon and PCSK1 (also known as prohormone convertase 3 (PC3 gene)). PMID: 25601282
  3. The results suggested that clusterin may contribute to gastrin's growth-promoting effect on the oxyntic mucosa. PMID: 21995960
  4. plays a role in the development of gastric mucosa, ECL cells and A-like cells in newborn and young rats PMID: 12220729
  5. role in increasing expression of COX-2 mRNA and protein, the activity of the COX-2 promoter, and the release of prostaglandin E(2) PMID: 12239223
  6. High temperature can affect gastrin, somatostatin and motilin production in the gastric antral mucosa of rats with gastric ulcer. PMID: 12376287
  7. study demonstrates that gastrin enhances gastric mucosal integrity through cyclooxygenase-2 PMID: 12388195
  8. Data suggest that distention of isolated rat stomach stimulates somatostatin release via cholinergic and non-cholinergic TTX-insensitive pathways, and that these pathways are responsible for distention-induced inhibition of gastrin release. PMID: 12508367
  9. gastrin induces Akt through activation of CCKB receptors and of intracellular calcium-dependent, PKC-independent, pathways PMID: 15351698
  10. the role of JAK-dependent pathways in the regulation of E-cadherin-dependent cell-cell adhesion by gastrin PMID: 15530849
  11. gastrin- and PACAP-stimulated secretion of histamine and pancreastatin is inhibited by somatostatin, misoprostol and galanin in enterochromaffin-like cells PMID: 15935492
  12. hypogastrinemia and impaired enterochromaffin cell function in the oxyntic mucosa of the stomach might be partially responsible for the reduction in body weight that occurs after gastric bypass PMID: 16645284
  13. G cells are luminal sampling chemomechanosensory cells whose gastrin secretion is regulated by neural, hormonal, luminal, and mechanical factors through protein kinase A activation, cAMP signaling, and mitogen-activated protein kinase phosphorylation. PMID: 19208342

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Gastrin/cholecystokinin family
Database Links
Promotions
Reward For Reviews
Free antibody trial
Contact Us

  Email: [email protected]
  Distributors Worldwide

Service

Phage Display Service

Antibody Service

Protein Service

Gene Synthesis Service

Oligo Synthesis Service

Related Articles
TWIK2 channel mediates inflammation, study finds SWISS-PROT: When and How to Use It Protein Acetylation: An Important Post-translational Modification in Eukaryotic Cells Oncogenes and Cancer Neuronal Markers and Neurodegenerative Diseases GPC3: The Next-Promising Target in Cancer Immunotherapy Claudin 18.2, is a 'Dark Horse' in Anti-tumour Therapy? What Are Histones: Unraveling Their Critical Roles in Disease Pathogenesis Non-Hodgkin's Lymphoma, One of Common Heterogeneous Malignant Tumors Information You Must Know about KCNN4 STAT3: a Key Transcriptional Regulator in Cancer The True Face of Tumor Suppressor Gene p53 MUC16 (CA125): a Promising Predictive Marker and Therapeutic Target in Cancer EGFR and Its Application in Cancer Therapy An Overview of Cell Death: Necrosis and Apoptosis The Overview of One Category of Important Cell Receptors: Receptor Tyrosine Kinases TNFRSF9: A Potent Immune-Stimulator in Cancer GCGR: A Regulator of Energy Balance Holds a Potential in Treatment Diabetes TNFR1: Elucidating Dual Mechanisms and Evolving as a Precision Therapeutic Target CCR8: a Specific Marker on Tregs Cells, the Next Promising Candidate for Antitumor Drugs! 2021 Insights on the CAR-T Cell Therapy: the Most Popular Targets for Solid Tumor! Cellular Senescence and Its Markers NKG2D, a Powerful Molecule Involved In CAR-T And Car-NK Cell Therapy DLL3: A New Molecular Target in Cancer Chemokine Receptor CCR4: the Key Role of CCR4+Treg Cells in Cancer Immunotherapy PTPRD: The Overlooked Signaling Hub from Neurodevelopment to Cancer Suppression CLDN6: A "New Favorite" in Targeted Cancer Therapy after CLDN 18.2! CLDN9: Another Key Regulator for Tumors or Hearing Loss from the CLDN Family! DDR1: a Novel Member of the RTKs Family, a Potential Target for Tumor Therapy! TPBG/5T4: the Oncofetal Protein, an Appealing Target for ADC or Vaccine Therapeutics in Tumors! Intestinal Mucosal Barrier Bodyguard --ALPi The Collection of Progress of Anti-GPCR Antibody Drugs With the High Potential in Cancer Immunotherapy, CD40 Is Triggering Attention Surface Markers That Help You Identify Lymphocytes ERBB3/HER3: a New Target for Tumor Therapy, a Driver Gene of Multi-Tumors CLDN4: A Potential Prognostic Indicator and Therapeutic Target in Tumors！ SLC7A11: a New Potential Therapeutic Target via Induced Ferroptosis in Tumors! Differentiation of Th17 Cells and Their Roles in Health and Disease ULBP1: a Potent Member of NKG2D Ligands in CAR-T Therapy for Multiple Hematological and Solid Tumors! Knowledge about Transthyretin 63.9% Objective Response Rate! B7-H3 Targeted Therapy Transforms Small Cell Lung Cancer Treatment, Domestic Players Compete in Hundred-Billion-Yuan Market Effects of FSHR on Fertility and Tumors DSG2: a Vital Member of Desmosomal Cadherin Family, an Exciting New Target for Cardiomyopathy, Adenovirus, and Tumors! MYL9: a New Member of Myosin Motors, a Key Driver of Cancer Cell Dynamic Regulation? ZG16B: A New Tumor Biomarker Offers Important Insights for Drug Development in Pancreatic Cancer! CEACAM8: a Member of CEA Family, Emerging as a Vital Player in Gynaecological or Gastrointestinal Cancer Research! IL-6-Do You Really Know That? CEACAM5: A Promising Member of CEACAM Family, A Potential Target for ADC Drug Research! DKK1: a Well-Characterized Wnt Inhibitor, a Multifunctional Regulator in Multiple Cancers! The Application of IHC in Pathological Diagnosis LPS/TLR4 Signal Transduction Pathway Toll-like Receptors--The Eye of Innate Immunity CD47, A New Target for Tumor Immune What Is Immune Checkpoint Therapy? Tumor Necrosis Factor Receptor Superfamily and Apoptosis Understanding of Serum Albumin VSIG4: a Prominent B7 Family Costimulatory Molecule or Complement Receptor in Cancers and Inflammatory Diseases! Monoclonal Antibody Drugs Overview SLC39A6/ZIP6: a Key Member of Zinc Transporters, a Novel Targeting Antigen of ADC! What You Have To Know about Lung Cancer TMEFF2: a Tumor-Specific Methylated Biomarker, a Novel Target in Multiple Cancers Protein Kinases Overview: Definition, Types, Function, Activation Mechanism, etc. The Overview of Hippo Signaling Pathway CD44- A Powerful Bridge Between Cells A groundbreaking breakthrough! Domestic "sandwich" regimen boosts 2-year survival rate to 97% in B-ALL patients, as the CD22 target achieves another success. What Powerful Model Organism Databases Protein Tyrosine Kinases: Anti-tumor Targets to be Explored Urgently GIPR: the Crucial Regulator of Glucose and Lipid Metabolism in Diabetes and Obesity! Histone modification and Cancer CD48: An Emerging Human Immune Co-stimulatory Molecule, Friend or Foe? What Essential Biological Knowledge is Needed for Hepatocellular Carcinoma Research? GPCR Drugs Discovery Introduction of Hepatocellular Carcinoma Related Signaling Pathways Accelerating Diverse Antibody Discovery: The Power of Single B Cell Platforms SIGIRR: A Novel Member of the TIR Superfamily Acts as the Anti-Inflammatory 'Brake' to Control Immune Response in Various Diseases! Mesothelin: A Rising Star of Cancer Immunotherapy ACE2, The Hottest Target of SARS-CoV-2 Invasion PD-1-- An Important Immune Checkpoint Tetraspanin CD81: a Key Receptor for Hepatitis C Virus (HCV), an Established Exosome Marker, a Promising Target for Antiviral or Antitumor Research! CRTAM: Class I Restricted T cell-associated Molecule, an Intriguing New Member of the Ig-SF Family! TMPRSS2, an Activator for SARS-CoV-2 Invasion TROP2, An Important Target for Cancer Research GLP-1R: An Energy Metabolism Regulator of GPCR Family, an Effective Drug Target for Type 2 Diabetes Therapy! Latest Changes in Journal Impact Factor TM4SF1: a Member of the Transmembrane-4-Superfamily (L6), a New Vascular Therapeutic Target? Surface Markers of Natural Killer Cells LY6G6D (LY6-G): A New Member of Lymphocyte Antigen-6 Family Holds Big Opportunities in Bispecific Antibody for CRC Treatment! Exploring the Science of Influenza A Virus: What You Need to Know Mucin-17/MUC17: An Unexpected Target for Tumor Immune Therapy, Notably Gastric Cancer! ANGPT2 (Ang-2): the First Bispecific Antibody for Eye Vision Loss Therapy, a Novel Target for Tumor Angiogenesis! Norwalk Virus ALPG: a Germ Cell-Associated Alkaline Phosphatase (ALP), a Highly Specific Cell Surface Antigen in Cancers! Myosin Regulatory Light Chains (MYL12A and MYL12B): the New Functional Ligands for CD69, Potential Targets for Cardiac Disease or Tumors Research? FAP may be a drug target for pancreatic cancer Inhibition of ASCT2 combats cancer in vitro and in vivo CD69: a Classical Early Marker of Lymphocyte Activation, a Pivotal Regulator of Hematologic Diseases and Autoimmune Disorders! PD-1/PD-L1, What a Powerful Immune Checkpoint EphA3-A Regulator of Cell Adhesion and Migration Cadherin-17 (CDH17): A Viable Target in Bispecific Antibodies or CAR-T Therapy to Fight Many Gastrointestinal Cancers! The Overview of Growth Factor Tumor Necrosis Factor (TNF) The Overview of Interferon Tumor markers The Oncogene HER2: a New Target for Drug-Resistant Tumors Cell Cycle Markers in Focus: From Basic Research to Biomarker Discovery in Oncology TTR: an Important Protein of Amyloidosis, Novel Therapies are Upcoming for Rare Diseases ATTR-CM and ATTR-PN! The overview of Wnt signaling pathway The Encyclopedia of Common Virus PI3K-Akt Signaling Pathway and Cancer Double-Edged Sword: TGF-β CCR9: A Member of the Chemokine Receptor Family, an Emerging Target for Numerous Tumor Researches! Chemokine Receptor CCR6: the Specific Receptor for CCL20, a Potential Target for Drug Research in Inflammatory Diseases and Gastrointestinal Cancer! CEACAM6: a Potent CEA Family Molecule, a New Tumor Marker or Anti-Cancer Target! What Should You Know about Exosomes? CXCR4: An Attractive Target of GPCR family Brings Promising New Drugs for Cancer Therapy！ CLDN3: Another Tight Junction Protein or New Drug Target, Interest in CLDN Family is Growing Fast! PROM1 (CD133): A New Cell Surface Marker of Cancer Stem Cells (CSCs), A More Significant Target for Immunotherapy! ENPP3 (CD203c): An Extracellular Enzyme, a Regulator for Nucleotide and Energy, an Indicator for Allergies, an Effective Target for RCC Therapy! GUCY2C: a Novel Target in Tumor Immunotherapy, Specially in Colorectal Cancer CAR T Therapy! SEMA4D/CD100: As an Important Immunoregulator to Improve Immunotherapy SSTR2: A Prominent Target in SSTR Family, Offers a More Precise Therapy in Neuroendocrine Tumors (NET) CADM1: an Immunoglobulin Superfamily Molecule, a New Tumor Suppressor Gene! Oncostatin M (OSM): A Member of IL-6 Cytokine Family, An Underestimated Player in Future Targeted Therapies? CNR1 (CB1): A Crucial Receptor of Endocannabinoid System Offers Potential Treatments for Tumors and Glycolipid Metabolism Disorders! Targeting LRRC15: From tumor microenvironment regulation to fibrotic/infectious disease therapy IL-6: an Important Participant in the Inflammatory Cascade, One of the Most Functional Cytokines in Various Diseases Research! CT83/KK-LC-1: a Promising Therapeutic Target of CTAs Family, Currently in Clinical Research for Breast, Lung, Gastric Cancers, and Beyond! New Power in the Fight Against Cancer: Spotlight on Rising Stars of ADC Drugs at the 2024 ASCO Annual Meeting Nectin-4: a Key Target in the IgSF Family, Boosting Clinical Drug Research in Various Tumors! Major Start to 2026: Impressive Clinical Data for CDH6-Targeting ADC, with Domestic Follow-Ups Close Behind Glycolysis Pathway: The Essential Energy Source for Cells, Even in Low-Oxygen Conditions TIGIT Targeted Immunotherapies Offer New Hope for Cancer Treatment CSF2/GM-CSF: A Key Molecule in Immune Regulation and Disease Treatment DLL4: A Key Target for Angiogenesis Regulation IL2's 'Double-Edged Sword' Strikes Again: PD1/IL2/VEGF Trispecific Antibodies Emerge at AACR 2026, Nektar's Autoimmune Data Sparks Heated Discussion CCL17: A Chemokine with Multiple Biological Functions Immune Battlefield's "Scout": Decoding the NCR3 Target Colony Stimulating Factor 1 (CSF1): Its Key Role in Diseases and New Progress in Targeted Therapy B7-H6: A Key Ligand of NK Cell Immune Checkpoints Reshaping the Landscape of Tumor Immunotherapy MICB: a key molecule that bridges cellular stress and immune responses MICA: key regulatory molecule for tumor immune surveillance and its therapeutic target potential LAG3: The Next Frontier in Tumor Immunotherapy Parathyroid Hormone (PTH): A Key Target for Regulating Calcium-Phosphate Metabolism and Skeletal Health The Metabolic Achilles' Heel of Cancer Stem Cells: New Mechanism of LGR5 Reveals Metformin's Anticancer Potential In-depth Dialogue on the "Core Triangle" of Inflammation: How IL-6, IL-1β, and TNF-α Interact to Drive Disease Progression? Targeting EphA2: An Emerging Focus in Combating Tumor Drug Resistance and Metastasis Macrophage Migration Inhibitory Factor (MIF): A Pleiotropic Target Linking Inflammation and Cancer GPR20: From "Orphan" to a Promising Novel Target for Overcoming Drug-Resistant GIST Groundbreaking! "Cancer Immunol Res": mRNA-LNP Targeting FAP Reprograms T Cells In Vivo, Outperforming Traditional CAR-T in Pancreatic Cancer PDGFRA: A Hub in Cellular Signaling and a Therapeutic Target The Multifaceted World of ADAM9: Beyond Proteolytic Function FCGR3A: A Key Receptor for Immune Regulation 2026 Trends in Macromolecular Drug Targets: GLP-1 Deepening, Cardiovascular Remodeling, Immune Combinations, and the "Post-PD-1" Era Beyond PD-1? The Potential and Breakthroughs of the Emerging Immune Checkpoint BTLA Emerging Therapeutic Target ANGPTL4: A Key Molecule Linking Metabolism, Inflammation, and Tissue Remodeling From "Physical Barrier" to "Signaling Hub": How Mucin MUC1 Drives Tumor Progression Spanning Eight Major Cancers: Why Has Transmembrane Mucin MUC13 Become a New Focus in Precision Tumor Therapy? CDH1/E-cadherin: Research Progress on a Core Target from Adhesion Regulation to Tumor Therapy Overview of CCR4 Target: Core Roles in Physiological Functions and Pathological Regulation CD28: Molecular Mechanism and Therapeutic Progress of the Core Co-Stimulatory Receptor in T Cells CCN2 (CTGF) Target: Core Molecule of Fibrosis and Tumor Stroma Regulation | Disease Treatment Research Progress Fibroblast Growth Factor 2 (FGF2): Molecular Mechanisms, Signaling Pathways, Disease Associations and Therapeutic Advances The CD200/CD200R Signaling Axis: A Critical “Brake” in Maintaining Immune Homeostasis Beyond PD-1: CD96 is Becoming the Next "Battleground" in Immunotherapy CUSABIO's Five Expression Systems General Information of Different Tags How to express a protein with bioactivity? How to choose a suitable expression vector? Applications of recombinant proteins Production of Recombinant Protein
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of email
Email
[email protected]
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Privacy Policy
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*