Recombinant Rat Gastrin (Gast)

In Stock
Code CSB-EP009273RA
Abbreviation Recombinant Rat Gast protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Gast
Uniprot No.
Research Area
Others
Alternative Names
Gast;Gas
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
22-104aa
Target Protein Sequence
SWKPRSQLQDASSGPRTNGALEQHQLEKLGPASHHRRQLGPQGPQHFIADLSKKQRPPMEEEEEAYGWMDFGRRSAEEEDQYN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
Gene References into Functions
  1. we examined the chronic effects of a GLP-1-gastrin dual agonist ZP3022 on glycemic control and beta cell dysfunction in overtly diabetic Zucker Diabetic Fatty PMID: 25849341
  2. treatment with gastrin, a CCK2R agonist, stimulated the secretion of GLP-1, and that this effect was likely due to increased expression of proglucagon and PCSK1 (also known as prohormone convertase 3 (PC3 gene)). PMID: 25601282
  3. The results suggested that clusterin may contribute to gastrin's growth-promoting effect on the oxyntic mucosa. PMID: 21995960
  4. plays a role in the development of gastric mucosa, ECL cells and A-like cells in newborn and young rats PMID: 12220729
  5. role in increasing expression of COX-2 mRNA and protein, the activity of the COX-2 promoter, and the release of prostaglandin E(2) PMID: 12239223
  6. High temperature can affect gastrin, somatostatin and motilin production in the gastric antral mucosa of rats with gastric ulcer. PMID: 12376287
  7. study demonstrates that gastrin enhances gastric mucosal integrity through cyclooxygenase-2 PMID: 12388195
  8. Data suggest that distention of isolated rat stomach stimulates somatostatin release via cholinergic and non-cholinergic TTX-insensitive pathways, and that these pathways are responsible for distention-induced inhibition of gastrin release. PMID: 12508367
  9. gastrin induces Akt through activation of CCKB receptors and of intracellular calcium-dependent, PKC-independent, pathways PMID: 15351698
  10. the role of JAK-dependent pathways in the regulation of E-cadherin-dependent cell-cell adhesion by gastrin PMID: 15530849
  11. gastrin- and PACAP-stimulated secretion of histamine and pancreastatin is inhibited by somatostatin, misoprostol and galanin in enterochromaffin-like cells PMID: 15935492
  12. hypogastrinemia and impaired enterochromaffin cell function in the oxyntic mucosa of the stomach might be partially responsible for the reduction in body weight that occurs after gastric bypass PMID: 16645284
  13. G cells are luminal sampling chemomechanosensory cells whose gastrin secretion is regulated by neural, hormonal, luminal, and mechanical factors through protein kinase A activation, cAMP signaling, and mitogen-activated protein kinase phosphorylation. PMID: 19208342

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Gastrin/cholecystokinin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*