Recombinant Rat Hemopexin (Hpx)

^{In Stock}

Code	CSB-EP010723RA
Abbreviation	Recombinant Rat Hpx protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP010723RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Hpx. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP010723RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Hpx.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Hpx

Uniprot No.

P20059

Research Area

Others

Alternative Names

Hpx; Hemopexin

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

24-460aa

Target Protein Sequence

NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

52.9kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Recombinant Rat Hemopexin is engineered specifically to cater to your research needs. The Hemopexin protein, encoded by the 'Hpx' gene in the Rat species, plays a pivotal role in heme binding and transportation, thus rendering it essential for studies related to heme metabolism.

Expressed in an E.coli system, this protein replicates the full length of the mature protein, ranging from amino acid 24 to 460. We have enhanced this protein with an N-terminal 6xHis tag for facilitating purification and tracking processes. A purity level of more than 90% ascertained by SDS-PAGE substantiates the high quality of the product. It is provided in both liquid and lyophilized powder forms to support your specific experimental requirements. Our Recombinant Rat Hemopexin guarantees high reliability and precision in your research.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Binds heme and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation.

Gene References into Functions

Data suggest that apo-hemopexin isolated from plasma exchibits low endogenous levels of tyrosine nitration in the peptide YYCFQGNQFLR in the heme-binding site of human hemopexin, which was similarly nitrated in rabbit and rat hemopexins; heme binding by hemopexin declined as tyrosine nitration proceeded in vitro. PMID: 28596380
Hemopexin was identified as upregulated protein in the small intestine exposed to indomethacin. PMID: 22486875
hemopexin mRNA was low or undetectable in livers of hypophysectomized rats, however, daily treatment with bovine growth hormone for 10 days restored hemopexin mRNA levels PMID: 12850285
intracellular calcium and protein kinase C activation are involved in the regulation of Hpx. PMID: 12850286

Subcellular Location

Secreted.

Protein Families

Hemopexin family

Tissue Specificity

Expressed by the liver and secreted in plasma.

Database Links

KEGG: rno:58917

STRING: 10116.ENSRNOP00000024710

UniGene: Rn.2380

Promotions