Recombinant Rat Natriuretic peptides B (Nppb), partial

In Stock
Code CSB-EP016021RA2
Abbreviation Recombinant Rat Nppb protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Brain natriuretic factor prohormone;Gamma-brain natriuretic peptide;Iso-ANP
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
27-102aa
Target Protein Sequence
HPLGSPSQSPEQSTMQKLLELIREKSEEMAQRQLSKDQGPTKELLKRVLRSQDSAFRIQERLRNSKMAHSSSCFGQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.6 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.248.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cardiac hormone that plays a key role in mediating cardio-renal homeostasis. May also function as a paracrine antifibrotic factor in the heart. Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins that drive various biological responses. Likely involved in regulating the extracellular fluid volume and maintaining the fluid-electrolyte balance through natriuresis, diuresis, kaluresis and chloruresis.
Gene References into Functions
  1. Data show that approximately 60% of natriuretic peptide precursor type B (Nppb)-/- females developed mesenteric polyarteritis-nodosa (PAN)-like vasculitis in their life span, some as early as 4 months of age. PMID: 27162120
  2. NT-proBNP and BNP are potential early biomarkers for 2-DG-induced cardiac toxicity that can be useful to monitor 2-DG therapy in clinical trials. PMID: 26838190
  3. Cardioprotective effects of rutin via alteration in TNF-alpha, CRP, and BNP levels coupled with antioxidant effect in STZ-induced diabetic rats. PMID: 27443845
  4. Despite preserved LV structure and function, treatment with GYY increased the levels of the natriuretic peptides ANP and BNP in association with enhanced cyclic GMP levels, paralleled by higher cGMP-dependent protein kinase type I (cGKI) protein levels PMID: 26254181
  5. This is due to the fact that ANP is the main hormone of the natriuretic peptide system involved in the regulation of blood pressure in normal conditions, while BNP is the principal regulator of pressure in cardiovascular pathology PMID: 27228659
  6. Serum NT-proBNP levels significantly increased after 5 hours of the blunt chest trauma. PMID: 26261563
  7. Akt dependent signaling is involved in mediating the cardioprotection afforded by intermittent BNP infusion at early reperfusion, and may also participate in regulation of reperfusion induced BNP expression. PMID: 25698234
  8. These results suggest that proBNP is processed into BNP intracellularly by furin PMID: 26136529
  9. daily rhythm in heart expression diminished under rotating light-dark regimen conditions PMID: 25669688
  10. BNP knockout Dahl salt-sensitive rats demonstrated adult-onset hypertension. Systemic BNP overexpression reversed this, demonstrating a critical role of BNP defect in the development of systemic hypertension and associated end-organ damage in adulthood. PMID: 26063669
  11. BMP antagonist Noggin was able to inhibit stretch and hypertrophic agonist induced BNP and ANP expression. PMID: 25218476
  12. hsTnT and NT-proBNP strongly associated with incident heart failure among a diverse cohort of individuals with mild to severe chronic kidney disease PMID: 25278510
  13. Studied effect of atorvastatin on serum oxidative stress and N-terminal brain natriuretic peptide expression in rats. PMID: 25063069
  14. These preliminary data give new insights into the relationship between natriuretic peptide signaling and sKATP in the myocardium. PMID: 24477916
  15. The data suggest that the natriuretic peptides may perform several biological actions on sensory neurons via their binding to natriuretic peptide receptor B(NPR-B) in the dorsal root ganglion (DRG). PMID: 23454171
  16. BNP and adiponectin play important roles in cardiovascular homeostasis regulation. We investigated BNP and adiponectin serum levels followed by isoproterenol administration in a model of myocardial damage and explored the relationship between them. PMID: 24289757
  17. In an animal model of prediabetes, left ventricular hypertrophy is already present and BNP is the best early marker. PMID: 23497124
  18. BNP and NPR-A are expressed in the dorsal horn ganglion, and expressions are elevated in rats with chronic nonbacterial prostatitis. PMID: 22474982
  19. Data show taht hyperaldosteronism worsens hypertension-induced fibrosis through 2 inhibition of antifibrotic factors (B-type natriuretic peptide and bone morphogenetic protein 4). PMID: 22547442
  20. acute myocardial ischemia can directly upregulate BNP expression at the translational and transcriptional levels PMID: 21951964
  21. Elderly had significantly higher NT-proBNP levels. PMID: 18032399
  22. The measurement of circulating NT-proBNP concentration may be useful to screen for the presence of macro- and/or microvascular complications in type 2 diabetes. PMID: 16357805
  23. found a close correlation between pulmonary embolism degree and gene-expression of ANP, and BNP in the cardiac chambers with a selective increase in the right chambers of the heart PMID: 20559433
  24. There was significant increase in BNP mRNA expression 3hr after acute myocardial ischemia. PMID: 18404982
  25. Regulation of BNP-45 gene expression occurred at transcription as well as post-transcription level. Systemic chronic hypoxia could result in heart failure, especially when the hypoxia is severe and prolonged. PMID: 19752486
  26. The beneficial effect of BNP in cultured cardiomyocytes subjected to reperfusion is associated with attenuation of opening of mitochondrial permeability transition pores, resultant mitochondrial dysfunction and apoptosis. PMID: 19721230
  27. Mechanical overload in combined models of hypertension determines the evolution of hypertrophy and synthesis and secretion of ANP and BNP. PMID: 20139323
  28. Ischemia/reperfusion is responsible for increased BNP mRNA myocardial content independent of changes of ventricular cavity diastolic volume. PMID: 20108079
  29. Distinct roles of mitogen-activated protein kinase pathways in GATA-4 transcription factor-mediated regulation of B-type natriuretic peptide gene. PMID: 11827958
  30. BNP secretion was increased 6-fold, BNP mRNA levels 3-fold, and BNP promoter activity 3-5-fold following T(3) treatment, which was accompanied by an increase in myocyte size, sarcomeric organization, and protein synthesis. PMID: 12562779
  31. Thus BNP, which increases cyclic GMP independently of NO, is an important approach to prevent growth in the diabetic myocardium, where endothelium-dependent mechanisms are compromised. PMID: 12941780
  32. cardiac brain natriuretic peptide is upregulated at the transcriptional and translational levels by pro-inflammatory cytokines PMID: 15081310
  33. Load-induced activation of BNP gene expression is independent of calcineurin, protein kinase C anad protein phosphatase 2A. PMID: 15837527
  34. discussion of molecular regulation of the brain natriuretic peptide gene [review] PMID: 15911064
  35. Rat BNP transfected into diabetic transgenic mice prevents the progression of diabetic nephropathy. PMID: 16917760
  36. Calcium-dependent secretion and gene expression of A- and B-type natriuretic peptides are similarly regulated by calmodulin kinase II-dependent mechanisms. PMID: 17332063
  37. in response to myocyte stretching, mRNA levels of the mechanosensitive K(+) channel TREK-1, Brain Natriuretic Peptide and Endothelin-1 receptor B were significantly greater in sub-endocardial myocardium than sub-epicardial myocardium. PMID: 17345093
  38. NPR-B is present in cultured rat GABAergic ACs, our results further suggest that NPs produced in ACs may also modulate their own activity. PMID: 17566658
  39. GATA binding sites at -90 and -81 in the rat BNP promoter are essential for the in vivo response to Ang II. PMID: 17587490
  40. BNP is a specific HIF-1alpha target gene PMID: 17822384
  41. Systemic BNP enhance reflex activation of cardiac vagal motoneurons, in parallel with the enhanced reflex bradycardia. Enhancement is due to an action before the vagal efferent arm of the reflex pathway. PMID: 17906112
  42. Partial left ventricular unloading regressed myocardial hypertrophy, reversed contractile dysfunction and normalized the mRNA BNP expression of failing rat hearts. PMID: 18006556
  43. Inflammation contributes specific cytokines, leading to the disregulation of cardiac ANF and BNP production observed during myocardial inflammation, and that this process is angiotensin receptor 1 dependent. PMID: 18408131
  44. Chromogranin B is a novel regulator of cardiomyocyte InsP(3)/Ca(2+)-dependent signaling, nuclear factor kappaB activity, and BNP production. PMID: 18420944
  45. Calcium imaging showed that application of brain natriuretic peptide (BNP) caused an increase in intracellular calcium concentrations at the axon terminal, and the increase monotonically decayed when the acting site was moved away from the axon terminal. PMID: 18499087
  46. BNP was capable of inhibiting VSMCs proliferation by NPRA/cGMP pathway PMID: 19104909
  47. YY1 activates hBNP transcription through interaction with histone deacetylase 2 in cardiac myocytes. PMID: 19139378

Show More

Hide All

Subcellular Location
[Brain natriuretic peptide 45]: Secreted.
Protein Families
Natriuretic peptide family
Tissue Specificity
Expressed in the atria and ventricles, but at much lower levels than NPPA. Expression levels in the ventricles are slightly higher than in the atria. Very low levels of expression detected in the brain, hypothalamaus, lung and aorta.; [Brain natriuretic p
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*