Home
Protein
Recombinant Proteins
Recombinant Rat Plasma kallikrein (Klkb1),Partial

Recombinant Rat Plasma kallikrein (Klkb1),Partial

^{In Stock}

Code	CSB-EP012461RA
Abbreviation	Recombinant Rat Klkb1 protein, partial
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Klkb1

Uniprot No.

P14272

Alternative Names

Klkb1; Klk3; PkPlasma kallikrein; EC 3.4.21.34; Fletcher factor; Kininogenin; Plasma prekallikrein) [Cleaved into: Plasma kallikrein heavy chain; Plasma kallikrein light chain]

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

391-638aa

Target Protein Sequence

IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

31.8kDa

Protein Length

Plasma kallikrein light chain

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Recombinant Rat Plasma kallikrein (Klkb1) (partial) is the Plasma kallikrein light chain corresponding to the amino acid sequence of 391-638. E.coli-expressed recombinant Klkb1 protein was fused with an N-terminal 6xHis-tag. It has a high purity (>90%) measured by SDS-PAGE. Based on the below functions, this Klkb1 protein may find uses in the studies of Klkb1-targeted MS therapeutic development and research.

Klkb1 is a specific direct regulator of blood-brain barrier (BBB) integrity. In the active central nervous system (CNS) lesions of patients with multiple sclerosis (MS), klkb1 precursor plasma kinin (PK) levels were significantly increased. PK deficiency or pharmacologic blockade makes the mice less prone to experimental autoimmune encephalomyelitis and is accompanied by a significant reduction of BBB destruction and CNS inflammation. Klkb1 inhibition can decrease cell invasion during neuroinflammation, which may provide a strategy against Ms.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin.

Subcellular Location

Secreted.

Protein Families

Peptidase S1 family, Plasma kallikrein subfamily

Database Links

STRING: 10116.ENSRNOP00000019237

UniGene: Rn.9880

Promotions