Recombinant Rat Progonadoliberin-1 (Gnrh1)

In Stock
Code CSB-EP009635RA
Abbreviation Recombinant Rat Gnrh1 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Developmental Biology
Alternative Names
(Progonadoliberin I)
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
24-92aa
Target Protein Sequence
QHWSYGLRPGGKRNTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Take your research to the next level with our Recombinant Rat Hemopexin. This specialized protein product, encoded by the Rat 'Hpx' gene, is at the heart of heme binding studies. Whether your work focuses on heme metabolism or broader physiological processes, our Hemopexin protein is crafted to meet your experimental requirements.

Our team meticulously develops this protein in an E.coli expression system, ensuring its structure spans the entire mature protein length from the 24th to the 460th amino acid. To optimize your work, we've appended an N-terminal 6xHis-tag to the protein, simplifying its purification and detection in your experiments. With a confirmed purity level exceeding 90% through SDS-PAGE analysis, the quality of this product is guaranteed. Choose between the convenience of a liquid form or the long-lasting stability of a lyophilized powder. Trust in our Recombinant Rat Hemopexin to deliver precise and dependable results.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
Gene References into Functions
  1. GnRH-R in the mammary tissues after weaning; GnRH is involved in the involution and tissue remodeling of post-lactating rat mammary tissues PMID: 27349532
  2. Under-nutrition delayed puberty onset and decreased hypothalamic GnRH expression. PMID: 24668712
  3. Data show that within the hypothalamus, zearalenone (ZEA) and Ethinyl estradiol (EE2) directly activate anteroventral and periventricular kisspeptin (KP) neurons to stimulate gonadotropin releasing hormone (GnRH) mRNA. PMID: 26248220
  4. Disruption of GnRH/GnRHR signaling may be important for the management of cholestatic liver diseases. PMID: 25794706
  5. Data indicate that RNA interference of NEL-like protein 2 (NELL2) reduced NELL2 and gonadotropin-releasing hormone (GnRH) expression at multiple stages of sexual development. PMID: 25177948
  6. Downregulation of Gnrh may be involved in the development of sex hormone disorder and calcium loss. PMID: 25048263
  7. the S-100 containing cells in pars tuberalis were first detected on day 30 and increased in number to day 60; this was parallel to the immunohistochemical staining of gap junction protein, connexin 43. LH-RH positive sites PMID: 24216131
  8. Maternal dexamethasone exposure affects the number and dendritic development of early postnatal GnRH neurons. PMID: 24374911
  9. Our findings strongly suggest that the TGF-beta signaling pathway may be one of the major causes responsible for prostate volume reduction in BPH rats after cetrorelix treatment. PMID: 22684563
  10. Data indicate that the suppression of the GnRH pulse generator by acute systemic stress equires hypothalamic NKB/neurokinin B (NKB) receptor (NK3R) signaling. PMID: 24708241
  11. Our findings suggest that the ventral premammillary nucleus is a component of the neural circuitry that modulates the physiologic fluctuations of Kiss1 and GnRH in the control of the female reproductive physiology. PMID: 23518222
  12. Data indicate cocaine- and amphetamine-regulated transcript (CART) as a potent stimulator of Kiss1 and GnRH neurons and suppression of CART expression during negative metabolic conditions could contribute to inhibition of the reproductive axis. PMID: 23736294
  13. Data inidcate that the combination of a GnRH agonist with antagonist completely prevented the flare-up effect and enhanced the protective effect of the ovary from cisplatin-induced gonadotoxicity. PMID: 23452939
  14. Data provide evidence for communication between COX-1 (cyclooxygenase 1-) expressing, ramified/branched microglia and GnRH-secreting neurons in preoptic area; expression of COX-1/GnRH is not affected by estrogen replacement. PMID: 23090753
  15. Data indicate that Dabuyin Wan down-regulated expressions of GnRH, GPR54 and Kiss-1 mRNA in hypothalamus. PMID: 23668015
  16. These findings suggest that atrazine acts to inhibit the secretory dynamics of gonadotropin-releasing hormone (GnRH) pulses without interfering with GnRH mRNA and protein synthesis. PMID: 23197165
  17. These findings suggest that somatostatin directly inhibits the activity of rat GnRH neurons through volume transmission in the organum vasculosum of the lamina terminalis region. PMID: 22147011
  18. remarkable cellular and subcellular distribution led us to test the effect of URP on the GnRH-induced gonadotrophins release in the anterior pituitary, and to discuss its putative role at the level of the median eminence PMID: 22039515
  19. Differences between the degradation velocities of guinea pig GnRH and mammalian GnRH in serum are not proportional to the large differences between the biological activities of these two peptides, in particular in the rat. PMID: 20970475
  20. Direct control of opioids via delta-receptors(DOR) occurs on GnRH neurons and validates use of GT1 cells to further investigate nature of DOR present on GnRH neurons. (Delta receptor, GnRH) PMID: 16405927
  21. After intracerebroventricular infusion of native GnRH, blood plasma vasopressin concentration is significantly higher than in control animals, accompanied by decreased content of the hormone in the neurohypophysis. PMID: 20814074
  22. These results suggested that the delayed onset of puberty induced by maternal dexamethasone administration would occur independently of hypothalamic Kiss1-Kiss1r-GnRH system. PMID: 21074602
  23. Data demonstrate the occurrence of morphological and physiological changes in GnRH-expressing GnV-3 cells between the proliferating and the differentiated state. PMID: 20937356
  24. These results suggest that kisspeptin neurons regulate GnRH neurons not via the synaptic contact but via another information transmission process that is not synapse-dependent, such as volume transmission. PMID: 20680515
  25. GnRH mRNA levels are positively associated with PG mRNA levels.This may imply that GnRH influences hormones secretion in the pancreas by autocrine and paracrine effects on islet cells. PMID: 19856133
  26. Expression of mRNA of GnRH-1 in the hypothalamus is not a critical factor of gonad growth in early postnatal development of male rats. PMID: 20380165
  27. Exaggerated release of gonadotropins in rats primed with GnRH antagonist and treated with GnRH agonist was due to an increase in releasable gonadotropin pools coupled with a reduction in GnRH-R, but receptor function was preserved. PMID: 19200975
  28. kisspeptin-GPR54 signalling in this region of the mediobasal hypothalamus is a critical neural component of the hypothalamic GnRH pulse generator. PMID: 20016824
  29. These results suggest that the expression of LHbeta in the ovary is regulated by locally produced GnRH and by FSH from either the ovary or the pituitary. PMID: 19253008
  30. Although the GnRH immunofluorescent signal showed no significant changes with age and estradiol treatment, the median eminence underwent both qualitative and quantitative structural changes with age. PMID: 19819960
  31. Our data suggest reproductive aging in rats is characterized by structural organizational changes to the GnRH terminal microenvironment in the median eminence. PMID: 19757493
  32. GnRH release from male marmoset monkey hypothalamic tissue is different in comparison to release dynamics from male rat, suggesting a species difference in feedback regulation of GnRH release. PMID: 19889867
  33. the enhancer and promoter regions of the rat GnRH gene are necessary for targeted expression to hypothalamic neurons PMID: 11897697
  34. Age-related changes in hypothalamic gonadotropin-releasing hormone and N-methyl-D-aspartate receptor gene expression, and their regulation by oestrogen, in the female rat. PMID: 11963827
  35. The data suggest that adhesion-related kinase suppresses GnRH gene expression via the coordinated activation of a Rac-ERK signaling pathway and a distinct MEF2- dependent mechanism. PMID: 12138087
  36. episodic GnRH gene expression is a promoter-dependent phenomenon, which is mediated by Oct-1 interaction with regulatory elements in the NSE region PMID: 12198245
  37. Neuron-restricted expression is conferred by a cell-specific protein complex that binds repeated CAATT elements. PMID: 12403831
  38. Leptin can act at both the cell bodies and axon terminals of GnRH neurons to stimulate the release of the neurohormone in vivo. PMID: 12433965
  39. Anterior pituitary cells undergo a cyclic change in apoptotic cell death during the estrous cycle and the inhibition of apoptosis on estrus is due, at least in part, to the proestrous surge of GnRH secretion. PMID: 12457038
  40. hypothalamic GnRH input drives the postnatal decline in pituitary melatonin receptor gene expression PMID: 12598657
  41. GnRH is involved in thymic growth and may be important for maturation of T lymphocytes. PMID: 12639934
  42. GnRH neurons were colocalized with the orexin receptor 1 (OX-R1), and the OX-R1-expressing GnRH neurons were contacted by orexin terminals, providing the basis for a functional neuroanatomical pathway. PMID: 12639939
  43. gonadotropin releasing hormone may be involved in the functional regulation of the submaxillary gland through autocrine or paracrine activity PMID: 12697272
  44. Ca/CAMK II plays a central role in the transmission of pulsatile GnRH signals from the plasma membrane to the rat alpha, LHbeta, and FSHbeta subunit genes. PMID: 12810529
  45. GnRH signaling seems to involve adenylyl cyclase activation, PKC stimulation, and ERK1/2 phosphorylation. PMID: 12810551
  46. the mast cell increase seen in a reproductive context is the result of a parallel increase in GnRH-I positive and non-GnRH-I positive mast cells PMID: 12838577
  47. results demonstrate that prolactin decreases annexin 5 mRNA in the luteal cells during pseudopregnancy possibly by suppressing action of gonadotropin releasing hormone PMID: 12865345
  48. TGFbeta(1) is unable to directly modulate decapeptide release from GnRH nerve terminals. Astrocyte-derived TGFbeta(1) may directly influence GnRH expression and/or secretion in vivo by acting on perikarya, but not terminals, of GnRH neurons. PMID: 14670985
  49. Carboxypeptidase E (CPE) is key enzyme for pro-GnRH processing. Reproductive deficits in Cpe(fat/fat) males appear to be due primarily to abnormal sexual behavior. PMID: 14715715
  50. expression of the GnRH gene is regulated in neurons by TALE homeodomain proteins and Oct-1 PMID: 15138251

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
GnRH family
Tissue Specificity
Central nervous system.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*