Recombinant Rat Pulmonary surfactant-associated protein A (Sftpa1)

In Stock
Code CSB-MP021168RA
Abbreviation Recombinant Rat Sftpa1 protein
MSDS
Size $290
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
PSAP;PSP-A;SP-A
Species
Rattus norvegicus (Rat)
Source
Mammalian cell
Expression Region
21-248aa
Target Protein Sequence
NVTDVCAGSPGIPGAPGNHGLPGRDGRDGVKGDPGPPGPMGPPGGMPGLPGRDGLPGAPGAPGERGDKGEPGERGLPGFPAYLDEELQTELYEIKHQILQTMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKKYNNYVYLGMIEDQTPGDFHYLDGASVNYTNWYPGEPRGQGKEKCVEMYTDGTWNDRGCLQYRLAVCEF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.
Gene References into Functions
  1. SP-A expression was up-regulated in the middle ear effusion of non-typeable Haemophilus influenza otitis media. PMID: 30055742
  2. SPA binds dipalmitoyl-phosphatidylcholine, the major surfactant lipid component, but not phosphatidylinositol; SPD exhibits the opposite preference. Data suggest flexibility in a key surface loop supports distinctive lipid binding of SPA; quadruple mutant SPA (E171D/P175E/R197N/K203D) that introduces SPD-like loop-stabilizing Ca2+ binding site in carbohydrate recognition domain exhibits ligand-binding preferences of SPD. PMID: 28719181
  3. Downregulation of SP-A expression caused due to silica is an important factor in the occurrence and development of silicosis. PMID: 27660222
  4. Liraglutide activates the GLP1 receptor, increasing ACE2 expression, reversing right ventricle hypertrophy, and improving the production of SP-A and SP-B in the lungs of Type 1 Diabetes rats PMID: 26196539
  5. Mutations of rat surfactant protein A have distinct effects on its glycosylation, secretion, aggregation and degradation. PMID: 25242514
  6. Dual positive effects of leptin were found on protein expression and transcriptional activity of thyroid transcription factor-1 PMID: 23894445
  7. VIP can up-regulate the expression of SP-A in alveolar type II cells. PMID: 21166190
  8. NG-nitro-L-arginine can protect the lung from LPS-induced injury by up-regulating the expression of PS. PMID: 20663300
  9. A novel role is demonstrated for SP-A in modulating endolysosomal trafficking via Rab7b (but not Rab5 nor Rab11) in primary alveolar macrophages, and the biochemical pathways are defined. PMID: 21248257
  10. SP-A stimulates the release of neutrophil chemotactic factor by alveolar type II cells, and this effect is mediated by the receptor for SP-A specifically expressed by these cells. PMID: 20473679
  11. VIP elevated SP-A expression in ATII cells which was mediated by enhanced sp-a gene transcription PMID: 20688121
  12. crystal structures of calcium-dependent complexes of the C-terminal neck and carbohydrate recognition domain of SP-A with carbohydrates PMID: 21047777
  13. The SPA level decreases significantly in acute pulmonary embolism. PMID: 16207426
  14. Data suggest that the pathway for secretion of newly synthesized surfactant protein-A is by transfer from the site of synthesis to the storage/secretory organelle prior to lamellar body exocytosis. PMID: 20382745
  15. the ability of SP-A to inhibit immune cell activation by Re-LPS may be due to its ability to block the binding of Re-LPS to LBP and prevent the initiation of the LBP/CD14 pathway for inflammatory reactions in the lung. PMID: 12204898
  16. SP-A selectively enhances mannose receptor expression on monocyte-derived macrophages, a process involving both the attached sugars and collagen-like domain of SP-A. PMID: 12244146
  17. SP-A can reverse the detrimental effects of surfactant oxidation on the biophysical properties of surfactant, by a mechanism that is dependent on interchain disulfide bond formation and the C-terminal domains of the protein. PMID: 12600986
  18. SP-A and SP-D are antimicrobial proteins that directly inhibit the growth of Histoplasma capsulatum by increasing permeability of the organism PMID: 12857753
  19. blocks secretagogue-stimulated phospholipid release, even in the presence of surfactant-like lipid PMID: 12882765
  20. Results suggest that there is no primary deficiency of surfactant proteins A, B, or C in the nitrofen-induced rat model of congenital diaphragmatic hernia. PMID: 12904592
  21. Crystal structure of trimeric carbohydrate recognition and neck domains of surfactant protein A PMID: 12913002
  22. SP-A enhances the phagocytosis of S. pneumoniae by alveolar macrophages through a CK2-dependent increase of cell surface SR-A localization (scavenger receptor a) PMID: 14993215
  23. SP-A and SP-D enhance mannose receptor-mediated phagocytosis of M. avium by macrophages PMID: 15187139
  24. Differential allele-specific expression was observed in all tissues studied (OPN) or in all extrapulmonary tissues (SP-A). Double heterozygous rats revealed lack of coordinate allele expression among SP-A, SP-D, and OPN. PMID: 15482851
  25. NO mediated the decrease in surfactant protein gene expression PMID: 15640287
  26. We suggest that enhanced release of surfactant phospholipids and SP-A represents an early protective response that compensates in part for the inactivation of intraalveolar surfactant in the early phase of IR injury. PMID: 15969762
  27. The addition of rat or recombinant rat SP-A to human monocyte-derived macrophages significantly raises the level of cytosolic calcium above baseline within 10 seconds of SP-A addition PMID: 16081790
  28. SP-A and Prdx6 directly interact, which provides a mechanism for regulation of the PLA(2) activity of Prdx6 by SP-A PMID: 16330552
  29. results indicated SP-A & SP-D have distinct functions in lung homeostasis & the function of the neck domain & carbohydrate recognition domain of SP-D is dependent on its own NH2-terminal & collagenous domains that cannot be complemented by those of SP-A PMID: 16500946
  30. Direct effect of SFTPA1 on rat myometrial cells and inhibitory cross talk between SFTPA1 and LPS signals. PMID: 17202387
  31. SP-A2 enhances phagocytosis of Pseudomonas aeruginosa by rat alveolar macrophages more than does SP-A1. PMID: 17220308
  32. Air spaces of neonatal lungs comprised lower fractions of tubular myelinand increased unilamellar vesicles, which correlated with low SP-A concentrations in lung lavage fluid and increased respiratory rates, respectively PMID: 17469149
  33. alterations of surfactant are a consequence of the ventilation strategy that impair the biophysical activity of this material and thereby contribute directly to lung dysfunction over time PMID: 18344412
  34. cigarette smoke alone decreases the level of SP-A and that might have an important effect on surfactant metabolism and the host defense functions of surfactant in the peripheral airways PMID: 18480979
  35. After OVA challenge alveolar epithelial cells Type II (AEII) show a significantly higher expression of SP-A and SP-D leading also to higher amounts of both SPs in BALF, and macrophages gather predominantly SP-A. PMID: 18802356

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, surface film.
Protein Families
SFTPA family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*