Recombinant Rat Synapsin-1 (Syn1), partial

Code CSB-EP023002RA1
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Syn1
Uniprot No.
Research Area
Others
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
113-420aa
Target Protein Sequence
ARVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMTQALPR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
35.6 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
13-23 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Neuronal phosphoprotein that coats synaptic vesicles, binds to the cytoskeleton, and is believed to function in the regulation of neurotransmitter release.
Gene References into Functions
  1. The synapsin 1 in the insular cortex as a part of pathophysiological process that determines predisposition of Krushinsky-Molodkina rats to audiogenic seizures. PMID: 26923581
  2. SUMOylation of synapsin Ia (SynIa) at K687 is necessary for SynIa function. Replacement of endogenous SynIa with a non-SUMOylatable mutant decreases the size of the releasable vesicle pool and impairs stimulated SV exocytosis. PMID: 26173895
  3. Results suggest a mechanism of A2aR modulation of neurotransmitter release in cultured cells from medulla oblongata and suggest that protein kinase A mediates this modulation of neurotransmitter release via synapsin I phosphorylation PMID: 24912137
  4. rSynI(1.0)-minCMV drives robust and neuron-specific transgene expression throughout the CNS and is therefore useful for viral vector-mediated neuron-specific gene delivery and generation of neuron-specific transgenic animals. PMID: 24361760
  5. This study demonistrated that Increased activation of synapsin 1 in the amygdala of maternal separation rats. PMID: 24279756
  6. O-GlcNAcylation of Thr-87 interferes with folding of the ALPS motif, providing a means for regulating the association of synapsin I with SVs as a mechanism contributing to synapsin I localization and RPSV generation. PMID: 24280219
  7. The mean brightness of Syn1 per unit area of the dendritic tree of neurons changes over the estrous cycle, being approximately 35% lower at diestrus than at the remaining phases of the estrous cycle. PMID: 21948316
  8. A hybrid peptide consisting of synapsin carboxyl domain fused with E coli enterotoxin B subunit up-regulates expression of anti-inflammatory cytokines and diminishes myelin basic protein-specific T-helper cell responses in lymph nodes. PMID: 22138356
  9. Syn I phosphorylation at site 1 regulates synapse formation. PMID: 22045728
  10. Data provide a complete molecular pathway (GR/Egr-1/MAPK/Syn-Ia/Ib) through which stress and glucocorticoids enhance the memory of stress-related events and highlight the function of synapsin-Ia/Ib as molecular effector of the behavioral effects of stress PMID: 20368707
  11. Data show that Src-mediated tyrosine phosphorylation of synapsin I increases its binding to synaptic vesicles and actin, and increases the formation of synapsin dimers, which are both potentially involved in vesicle clustering. PMID: 20530578
  12. Data suggest that integrin-linked kinase exerts pleiotropic actions by regulating pre- and postsynaptic neural plasticities in response to repeated cocaine exposure through PSD-95 and synapsin I expression and GluR1 Ser845 phosphorylation. PMID: 19629758
  13. Either C-terminal domain E or a peptide derived from domain C was necessary and sufficient to inhibit both dimerization and vesicle clustering, indicating the participation of both domains in these activities of synapsin I. PMID: 19922412
  14. Seven days after fluid-percussion brain injury, synapsin I mRNA levels increase ipsilaterally and decrease contralaterally in the occipital cortex. PMID: 12184851
  15. These results raise the possibility that Ser(603) on synapsin I is alternatively phosphorylated by p21-activated kinases, not only by CaMKII, in neuronal cells in response to some stimulants. PMID: 12237306
  16. BEMAD methodology was validated by mapping three previously identified O-GlcNAc sites, as well as three novel sites, on Syn I. PMID: 12438562
  17. multiple signaling pathways serve to allow synapsin's control of vesicle mobilization over different stimulus frequencies. PMID: 12691665
  18. Time-dependent translocational changes of Synapsin I were investigated in regenerating axonal sprouts. PMID: 14612614
  19. Calorimetric measurements of ATP binding to wild-type and mutant recombinant Synapsin I-ABC demonstrate that the multifunctional loop and a cross-tetramer contact are important for ATP binding PMID: 14688264
  20. During the first postnatal week,synpsin 1 immunoreactive strongly concentrated in the Purkinje cell layer.By P14, synapsin 1 localized to many small puncta in the ML and to large clusters at mossy fiber rosettes in the glomerular layer. PMID: 15246689
  21. glucose-dependent actions of ERK1/2 in beta-cells exerted on cytoplasmic proteins, includes synapsin I and participates in the overall glucose-induced insulin secretion. PMID: 15498890
  22. In conclusion, this is the first evidence to show that PLD1 acts as an important regulator of neurite outgrowth in neural stem cell by promoting neuronal differentiation via increase of synapsin I expression. PMID: 15752728
  23. findings show that synapsin I plays a central role in regulating the organization and dynamics of synaptic vesicles in growth cones and that this activity is modulated by cAMP-dependent phosphorylation of the protein PMID: 16093379
  24. Neither haloperidol nor the dopamine-D1 receptor antagonist affected synapsin I protein expression. PMID: 16413126
  25. These results suggest, therefore, that Ca2+ entrance mediated by P2X7 receptor induces glutamate release and in parallel synapsin-I phosphorylation. PMID: 18242779
  26. Synapsin1a modulation by piccolo regulates synaptic vesicle exocytosis PMID: 18519737
  27. Data suggest that diabetes has a profound impact on synapsin I and other presynaptic protein expression in the retina, and may provide a mechanism for the well-established defects in vision and the electrophysiological response of the retina in diabetes. PMID: 18662330
  28. Synapsin I is embedded in open chromatin in R28 retinal precursor cells. PMID: 18692536
  29. Data show that long-term amygdala kindling increases synapsin I immunoreactivity bilaterally in most hippocampal subfields, but not in the caudate nucleus, sensorimotor cortices, or piriform cortex in rats. PMID: 18703092
  30. pentachlorophenol exposure during development causes thyroid function vulnerability, testicular hypertrophy in adults, and aberrations of brain gene expression of syn1 PMID: 19082768
  31. mW/cm(2) (SAR 14.1 W/kg) microwave radiation can result in the perturbation of the synaptic vesicles associated proteins: synapsin I, synaptophysin, VAMP-2, and syntaxin PMID: 19603498

Show More

Hide All

Subcellular Location
Cell junction, synapse. Golgi apparatus.
Protein Families
Synapsin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*