Recombinant Saccharomyces cerevisiae DNA-binding protein RAP1 (RAP1), partial

In Stock
Code CSB-EP319350SVG
Abbreviation Recombinant Saccharomyces cerevisiae RAP1 protein, partial
MSDS
Size $390
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
RAP1
Uniprot No.
Research Area
Others
Alternative Names
(Repressor/activator site-binding protein)(SBF-E)(TUF)
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Source
E.coli
Expression Region
353-598aa
Target Protein Sequence
GALPSHNKASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSLITDEDTPTAIARRNMTMDPNHVPGSEPNFAAYRTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNYNSAAKR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.7
Protein Length
Partial
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential regulatory protein in yeast whose DNA-binding sites are found at three types of chromosomal elements: promoters, silencers, and telomeres. RAP1 is also involved in the regulation of telomere structure, where its binding sites are found within the terminal poly[C(1-3)A] sequences. The opposite regulatory functions of RAP1 are not intrinsic to its binding sites but, instead, result from interactions with different factors at promoters and silencers. RAP1 associates with SIR3 and SIR4 proteins to form a DNA-binding complex that initiates the repression at the HM loci and telomeres. May also target the binding of RIF1 and RIF2 to silencers and telomeres. Forms with GCR1 a transcriptional activation complex that is required for expression of glycolytic and ribosomal gene.
Gene References into Functions
  1. Rap1 (ScRap1) can either activate or repress transcription. This bimodal transcriptional activity has led to the widespread study of the mode of action of ScRap1. This review summarizes current knowledge about ScRap1, including its structure, mechanisms of transcription regulation, and biological functions, and the future directions in the field. Review. PMID: 27100480
  2. Pif1, a 5'-3' helicase, not only stimulates the strand displacement activity of Pol delta but it also allows efficient replication through the Rap1 block, by removing bound Rap1 in front of the polymerase. PMID: 27001517
  3. that Rap1 contains an AD required for Rap1-dependent gene transcription. The Rap1(AS) variant will likely also be useful for studies of the functions of Rap1 in other biological pathways. PMID: 28196871
  4. Rap1 contributes to telomere homeostasis by promoting chromosome breakage. PMID: 26263073
  5. found that all arrangements of Rap1 sites tested are represented within the telomeric sequence and our data suggest that at telomeres Rap1 might form a nucleoprotein complex with a heterogeneous distribution of bound states PMID: 25637888
  6. Rap1 C-terminal (RCT) domain of yeast Rap1 modulate access to different DNA binding modes PMID: 25805496
  7. findings suggest a connection between Rap1p and cell wall homeostasis. PMID: 25481258
  8. while Rap1 DNA-binding domain forms a high-affinity 1:1 complex with its DNA recognition site, it can also form lower-affinity complexes with higher stoichiometries on DNA PMID: 25382181
  9. Rap1 relocalization is thus a novel mechanism connecting DNA damage responses (DDRs) at telomeres to global changes in chromatin and gene expression while driving the pace of senescence PMID: 23756653
  10. Rap1 may cause permanganate hypersensitivity of DNA by forming a pocket between the reactive cytosine and Arg580, driving the permanganate ion towards the C5-C6 bond of the cytosine. PMID: 23519416
  11. These data support a model in which Tbf1 and Rap1 collaborate to maintain genomic stability of short telomeres. PMID: 22130795
  12. Results reveal Rap1 structural adjustment upon DNA binding that involves a specific orientation of the C-terminal domain with regard to the DNA binding domain. PMID: 22139930
  13. Rap1p association with target promoter in the nucleus affects the composition of the exported mRNP, which in turn regulates mRNA decay in the cytoplasm. PMID: 22196725
  14. Results show that Rap1 contributes to local regions of chromatin structure by acting at both strong and weak binding sites, at proximal promoter regions and at sites farther upstream, over a very large fraction of the yeast genome. PMID: 21081559
  15. Structural comparison indicated that Rap1 BRCT domain adopts a global fold similar to other BRCT domains, implying some common structural aspects of BRCT domain family. PMID: 21187076
  16. Data suggest that Rap1 binding to multiple sites in a telomere array does not, by itself, promote formation of a more energetically stabile complex. PMID: 20826803
  17. Rap1 is essential to block nonhomologous end joining between telomeres PMID: 16096640
  18. The effect on global gene expression of loss of binding of Rap1. PMID: 17158163
  19. Rap1 binding is required for end concealment at long tracts and modulates telomerase access at chromosome ends. PMID: 17289918
  20. Rap1p represents a heretofore unrecognized regulator of TATA-binding protein PMID: 18195009
  21. Structural and functional studies of the RAP1 C-terminus reveal novel separation-of-function mutants. PMID: 18538788

Show More

Hide All

Subcellular Location
Nucleus. Chromosome, telomere.
Protein Families
RAP1 family
Database Links

KEGG: sce:YNL216W

STRING: 4932.YNL216W

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*