Recombinant Saccharomyces cerevisiae Polyphosphatase (PPX1)

In Stock
Code CSB-EP334459SVG
Abbreviation Recombinant Saccharomyces cerevisiae PPX1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP334459SVG could indicate that this peptide derived from E.coli-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP334459SVG could indicate that this peptide derived from E.coli-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PPX1
Uniprot No.
Research Area
Others
Alternative Names
PPX1; YHR201C; Exopolyphosphatase; ExopolyPase; EC 3.6.1.11; Metaphosphatase
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Source
E.coli
Expression Region
1-397aa
Target Protein Sequence
MSPLRKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.1kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

E.coli-expressed Recombinant Saccharomyces cerevisiae Exopolyphosphatase (PPX1) is a full-length protein carrying an N-terminal 6xHis-tag. It contains 397 amino acids and has a calculated molecular mass of 49.1 kDa. Its purity was determined by SDS-PAGE and reached up to 90%. The purified PPX1 migrated on the SDS–PAGE at a molecular weight of about 50 kDa. It was also identified and quantified using LC-MS/MS. This recombinant PPX1 protein may be used to immunize animals to produce specific antibodies or in the studies of PPX1-participating inorganic polyphosphate hydrolysis. In-stock PPX1 proteins are available.

Exopolyphosphatase PPX1 is a phosphatase enzyme that catalyzes the hydrolysis of inorganic polyphosphate (polyP) and contributes to the maintenance of the polyP dynamic balance in the cells. The polyP is believed to exert a regulatory role in the transition to bacterial dormancy. Seema M. Thayil etc. demonstrated that PPX1 is required for M. tuberculosis (Mtb) growth and persistence in necrotic lung lesions, which may suggest a way to shorten latent tuberculosis (TB) treatment by targeting “persister” bacillia through the repression of a small molecule inhibitor to PPX1. In addition to degrading polyP, PPX1 has been implicated directly in bacterial virulence.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Degradation of inorganic polyphosphates.
Gene References into Functions
  1. PPX1 has restricted role in polyphosphate metabolism. PMID: 25540006
  2. Inactivation of the PPX1 gene (encoding polyphosphate) substantially decreased exopolyphosphatase activities in the cytosol and mitochondrial fractions, the compartments where PPX1 activity was localized. PMID: 16779667
  3. Exopolyphosphatases in different cell compartments of Saccharomyces cerevisiae. PMID: 17140377
  4. Dynamics of yeast exopolyphosphatase (scPPX)catalysis reveals significant functional differences between structurally similar scPPX and family II pyrophosphatase. PMID: 17215253
  5. describe the high-resolution X-ray structures of yeast PPX1 PMID: 17599355
  6. Influence of carbon source on the activity of PPX1. PMID: 18294131

Show More

Hide All

Protein Families
PPase class C family
Database Links

KEGG: sce:YHR201C

STRING: 4932.YHR201C

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*