Home
Protein
Recombinant Proteins
Recombinant Salmonella typhimurium Protein prgI (prgI)

Recombinant Salmonella typhimurium Protein prgI (prgI)

^{In Stock}

Code	CSB-EP336905SXB
Abbreviation	Recombinant Salmonella typhimurium prgI protein
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP336905SXB could indicate that this peptide derived from E.coli-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) prgI. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP336905SXB could indicate that this peptide derived from E.coli-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) prgI.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

prgI

Uniprot No.

P41784

Research Area

Others

Alternative Names

prgI; STM2873; Protein PrgI

Species

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Source

E.coli

Expression Region

1-80aa

Target Protein Sequence

MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

24.9kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Unravel the mysteries of bacterial pathogenicity with the Recombinant Salmonella typhimurium prgI, a full-length Protein PrgI, a core component of the type III secretion system needle complex. Derived from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720), this protein is central to understanding the intricate mechanisms of bacterial invasion and immune evasion.

This recombinant prgI protein is produced in an E.coli system, spanning the entire sequence of 1-80 amino acids. It features an N-terminal 6xHis-SUMO tag, facilitating seamless purification and detection in various assays. Exemplifying robust purity standards, it surpasses 90% purity as determined by SDS-PAGE, ensuring unerring accuracy in your investigative outcomes. Available in the flexible options of liquid or lyophilized powder, it can be customized to your experimental setup. Bring the Recombinant Salmonella typhimurium prgI into your research sphere and elevate your studies on bacterial pathogenesis.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Required for invasion of epithelial cells.

Gene References into Functions

analysis of structural and functional similarity between the bacterial type III secretion system needle protein PrgI and the eukaryotic apoptosis Bcl-2 proteins PMID: 19823588
Thermodynamic characterization of the structural stability of the PrgI protein. PMID: 16501225
analysis of electrostatic surfaces of the type III secretion needle proteins PrgI, BsaL, and MxiH PMID: 17617421

Protein Families

MxiH/PrgI/YscF family

Database Links

KEGG: stm:STM2873

STRING: 99287.STM2873

Promotions