Name: Recombinant Sheep Beta-2-microglobulin (B2M)
Brand: CUSABIO
SKU: CSB-EP002486SH

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

B2M

Uniprot No.

Q6QAT4

Research Area

Cancer

Alternative Names

B2MBeta-2-microglobulin

Species

Ovis aries (Sheep)

Source

E.coli

Expression Region

21-118aa

Target Protein Sequence

IQRIPEVQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVNHVTLTQPKIVKWDRDL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

18.6 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

If I want to be standard quantification, do I need to do endotoxin removal?
In addition, does endotoxin removal have any effect on purity? For example, will purity be higher?

Thanks for your inquiry.
Recombinant Sheep Beta-2-microglobulin(B2M)
CSB-YP002486SH >> Yeast
CSB-EP002486SH >> E.coli
CSB-BP002486SH >> Baculovirus
CSB-MP002486SH >> Mammalian cell
Expression Region: 21-118aa; Full Length of Mature Protein
Tag Info: EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged; YP: N-terminal 6xHis-tagged
Expression Sequence:

IQRIPEVQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVNHVTLTQPKIVKWDRDL

As to whether the endotoxin needs to be removed, it depends on what experiment you do. Generally, the cell experiment will require the removal of endotoxin.
And there may be some loss of protein in the process of removal.

Target Background

Function

Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system.

Subcellular Location

Secreted.

Protein Families

Beta-2-microglobulin family

Database Links

KEGG: oas:443295

UniGene: Oar.1153

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP002486SH
Abbreviation	Recombinant Sheep B2M protein
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Sheep Beta-2-microglobulin (B2M)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage