Recombinant Sheep Beta-2-microglobulin(B2M)

In Stock
Code CSB-EP002486SH
Size US$1198Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names B2M
Uniprot No. Q6QAT4
Research Area Cancer
Alternative Names B2MBeta-2-microglobulin
Species Ovis aries (Sheep)
Source E.coli
Expression Region 21-118aa
Target Protein Sequence IQRIPEVQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVNHVTLTQPKIVKWDRDL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 18.6 kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time 3-7 business days
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

 Q&A
Q:

If I want to be standard quantification, do I need to do endotoxin removal?
In addition, does endotoxin removal have any effect on purity? For example, will purity be higher?

A:
Thanks for your inquiry.
Recombinant Sheep Beta-2-microglobulin(B2M)
CSB-YP002486SH >> Yeast
CSB-EP002486SH >> E.coli
CSB-BP002486SH >> Baculovirus
CSB-MP002486SH >> Mammalian cell
Expression Region: 21-118aa; Full Length of Mature Protein
Tag Info: EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged; YP: N-terminal 6xHis-tagged
Expression Sequence:

IQRIPEVQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVNHVTLTQPKIVKWDRDL


As to whether the endotoxin needs to be removed, it depends on what experiment you do. Generally, the cell experiment will require the removal of endotoxin.
And there may be some loss of protein in the process of removal.

Target Background

Function
(From Uniprot)
Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system.
Subcellular Location Secreted.
Protein Families Beta-2-microglobulin family
Database Links

KEGG: oas:443295

UniGene: Oar.1153

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1