Recombinant Sheep Interleukin-4 (IL4)

In Stock
Code CSB-EP011659SH
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP011659SH could indicate that this peptide derived from E.coli-expressed Ovis aries (Sheep) IL4.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP011659SH could indicate that this peptide derived from E.coli-expressed Ovis aries (Sheep) IL4.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
IL4
Uniprot No.
Research Area
Immunology
Alternative Names
IL4; IL-4Interleukin-4; IL-4; B-cell stimulatory factor 1; BSF-1; Lymphocyte stimulatory factor 1
Species
Ovis aries (Sheep)
Source
E.coli
Expression Region
25-135aa
Target Protein Sequence
HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
29.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10XHis-B2M-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Inserting the gene encoding the Ovis aries (Sheep) IL4 protein (25-135aa) into a plasmid vector results in the creation of recombinant plasmid, which is introduced into e.coli cells. e.coli cells that can survive in the presence of a specific antibiotic are selected, indicating successful uptake of the recombinant plasmid. The e.coli cells containing the recombinant plasmid are cultured under conditions promoting the expression of the gene of interest. A N-terminal 10XHis-B2M tag and C-terminal Myc tag is linked to the protein. After expression, affinity purification is used to isolate and purify the recombinant Ovis aries (Sheep) IL4 protein from the cell lysate. Denaturing SDS-PAGE is then applied to resolve the resulting recombinant Ovis aries (Sheep) IL4 protein, revealing a purity level exceeding 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages. Stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and through the induction of RUFY4.
Gene References into Functions
  1. Local production of the prototypic immunomodulatory cytokine IL-4 in transplanted corneal endothelium induces eosinophilia, inflammation, and rejection. PMID: 16081789
  2. Early IL-4 gene expression in abomasum is associated with resistance to Haemonchus infection. PMID: 27059919
Subcellular Location
Secreted.
Protein Families
IL-4/IL-13 family
Database Links

KEGG: oas:443327

UniGene: Oar.377

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*