Recombinant Sheep Interleukin-4(IL4)

Code CSB-YP011659SH
Product Type Recombinant Protein
Size US$2959
Uniprot No. P30368
Relevance Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Ovis aries (Sheep)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC
Research Area Immunology
Source Yeast
Gene Names IL4
Protein Names B-cell stimulatory factor 1
Expression Region 25-135aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 14.6 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.
Subcellular Location Secreted
Protein Families IL-4/IL-13 family
Database Links

KEGG: oas:443327

UniGene: Oar.377

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Fc epsilon RI signaling pathway
Hematopoietic cell lineage
IL-17 signaling pathway
T cell receptor signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation

Related Products

IL4 Antibodies

IL4 Antibodies for Ovis aries (Sheep)

IL4 Proteins

IL4 Proteins for Ovis aries (Sheep)

IL4 ELISA Kit

IL4 ELISA Kit for Ovis aries (Sheep)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.