Recombinant Staphylococcus aureus Enterotoxin type H(entH)


In Stock
Code CSB-YP357926FKZ
Product Type Recombinant Protein
Size US$2959Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P0A0M0
Relevance Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP357926FKZ could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus entH.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP357926FKZ could indicate that this peptide derived from Yeast-expressed Staphylococcus aureus entH.
Storage Buffer Tris-based buffer,50% glycerol
Alias SEH
Species Staphylococcus aureus
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV
Research Area others
Source Yeast
Gene Names entH
Protein Names Recommended name: Enterotoxin type H Alternative name(s): SEH
Expression Region 25-241aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 27.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
Subcellular Location Secreted
Protein Families Staphylococcal/streptococcal toxin family

Related Products

entH Antibodies

entH Antibodies for Staphylococcus aureus

entH Proteins

entH Proteins for Staphylococcus aureus

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.