Recombinant Staphylococcus aureus Enterotoxin type H(entH)

Code CSB-EP357926FKZ
Product Type Recombinant Protein
Size US$2466
Uniprot No. P0A0M0
Relevance Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias SEH
Species Staphylococcus aureus
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV
Research Area Others
Source E.coli
Gene Names entH
Protein Names Recommended name: Enterotoxin type H Alternative name(s): SEH
Expression Region 25-241aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 41.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
Subcellular Location Secreted
Protein Families Staphylococcal/streptococcal toxin family

Q&A and Customer Reviews

Q&A
Q:

I purchased CSB-EP357926FKZ SEH 50 µg from Cosmo Bio Co., Ltd. I would like to remove SUMO tag from this enterotoxin. Please let me know the most preferable enzyme removing SUMO tag. I searched these enzymes and found SUMO protease1, SUMO Protease 2, and SUMOstar Protease from LifeSensors, Inc.

A:
Very nice to receive your inquiry. CSB-EP357926FKZ You could try enzyme digestion, but we can not guarantee 100% success under the influence of various conditions.
The sumo enzyme we used is a self-produced product CSB-EP311619SVG. And we generally use self-produced enzyme to removal tag.
We have reviewed the three enzymes of LifeSensors. Our self-produced enzyme is Ulp1, and you could try SUMO protease1 from LifeSensors.
Customer Reviews

Related Products

entH Antibodies

entH Antibodies for Staphylococcus aureus

entH Proteins

entH Proteins for Staphylococcus aureus

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.