Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase(apt)

In Stock
Code CSB-YP001954SMT
Product Type Recombinant Protein
Size US$2959Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P63546
Lead Time 3-7 business days
Relevance Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Streptococcus pyogenes serotype M1
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG
Research Area others
Source Yeast
Gene Names apt
Protein Names Recommended name: Adenine phosphoribosyltransferase Short name= APRT EC= 2.4.2.7
Expression Region 1-172aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 22.7kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Subcellular Location Cytoplasm
Protein Families Purine/pyrimidine phosphoribosyltransferase family
Database Links

KEGG: spy:SPy_0927

STRING: 160490.SPy_0927

Related Products

apt Proteins

apt Proteins for Streptococcus pyogenes serotype M1

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.