Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP001954SMT |
| Product Type | Recombinant Protein |
| Size |
US$2959Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | P63546 |
| Lead Time | 3-7 business days |
| Relevance | Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Streptococcus pyogenes serotype M1 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG |
| Research Area | others |
| Source | Yeast |
| Gene Names | apt |
| Protein Names | Recommended name: Adenine phosphoribosyltransferase Short name= APRT EC= 2.4.2.7 |
| Expression Region | 1-172aa |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Mol. Weight | 22.7kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. |
| Subcellular Location | Cytoplasm |
| Protein Families | Purine/pyrimidine phosphoribosyltransferase family |
| Database Links |
KEGG: spy:SPy_0927 STRING: 160490.SPy_0927 |
apt Proteins for Streptococcus pyogenes serotype M1
| Code | Product Name | Source |
|---|---|---|
| CSB-BP001954SMT | Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase(apt) | Baculovirus |
| CSB-EP001954SMT CSB-MP001954SMT |
Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase(apt) | E.coli Mammalian cell |
Recombinant Human Estrogen receptor beta(ESR2),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human UDP-glucuronosyltransferase 1-1(UGT1A1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human L-dopachrome tautomerase (DCT),Partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Plasminogen activator inhibitor 2 type A(Serpinb2)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Peroxisomal multifunctional enzyme type 2(HSD17B4)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human V-type proton ATPase subunit d 1(ATP6V0D1)
Express system: E.coli
Species: Homo sapiens (Human)
