Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase (apt)

In Stock
Code CSB-BP001954SMT
Abbreviation Recombinant Streptococcus pyogenes serotype M1 apt protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of CSB-BP001954SMT could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M1 apt.
  • Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of CSB-BP001954SMT could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M1 apt.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
apt
Uniprot No.
Research Area
others
Alternative Names
apt; SPy_0927; M5005_Spy0728Adenine phosphoribosyltransferase; APRT; EC 2.4.2.7
Species
Streptococcus pyogenes serotype M1
Source
Baculovirus
Expression Region
1-172aa
Target Protein Sequence
MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.7kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase is produced using the baculovirus expression system. This full-length protein spans amino acids 1 to 172 and comes tagged with an N-terminal 10xHis-tag and a C-terminal Myc-tag, which appears to make purification and detection more straightforward. SDS-PAGE analysis indicates a purity greater than 90%, suggesting it may be suitable for various research applications.

Adenine phosphoribosyltransferase is an enzyme that works within the purine salvage pathway, where it catalyzes the conversion of adenine to AMP. This protein likely plays an important role in nucleotide metabolism by helping recycle adenine efficiently. Studying it could shed light on purine metabolism and might offer insights into bacterial physiology—perhaps even revealing potential antimicrobial targets.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Immunoassay Studies

This recombinant protease serves as an excellent immunogen for generating specific antibodies. The full-length sequence ensures comprehensive epitope coverage. Even if the protease is misfolded or inactive, it will still generate antibodies against linear epitopes useful for techniques like Western blotting. The high purity and dual tags facilitate efficient immunization and screening.

2. Protein-Protein Interaction Studies

The utility for interaction studies is highly dependent on the correct folding of this APT protein. A properly folded protease could identify physiological substrates or regulators. However, a misfolded protease may expose non-specific hydrophobic surfaces, leading to false-positive interactions, or mask authentic binding sites, causing false-negatives. Data would be uninterpretable without folding validation. Protease-substrate/inhibitor interactions require a precise active site conformation. Using a protease of unknown folding state carries an unacceptably high risk of generating artifactual, misleading results.

3. Enzymatic Activity Assays and Inhibitor Screening

This application is entirely contingent on the protease being both correctly folded and active. If functional, this recombinant APT protein would be vital for characterizing kinetics, substrate specificity, and screening inhibitors. However, without activity confirmation, any assay will yield meaningless results, wasting resources and potentially leading to incorrect conclusions.

4. Biochemical Characterization and Folding Analysis

This application is the essential first step to determine the protein's folding state and stability. Techniques like size-exclusion chromatography (SEC) can assess oligomeric state and homogeneity, while circular dichroism (CD) can analyze secondary structure. These studies provide critical data on whether the protein is natively folded—a prerequisite for any functional study.

Final Recommendation & Action Plan

The unknown folding state and enzymatic activity mandate a strict, sequential approach. The immediate and mandatory first step is Application 4 (Biochemical Characterization) to assess folding quality via SEC and CD. If the protein is monodisperse and has a structured spectrum, the next critical step is to perform a basic enzymatic activity assay using a fluorogenic or chromogenic substrate to confirm functionality. Only after successfully confirming both correct folding and enzymatic activity can the protein be responsibly used for Application 3 (Enzymatic Assays) and Application 2 (Interaction Studies). Until this validation is complete, Application 1 (Antibody Development) is the only safe and reliable use for this protein reagent. Investing in functional studies before this validation is high-risk and likely to generate unreliable data.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Subcellular Location
Cytoplasm.
Protein Families
Purine/pyrimidine phosphoribosyltransferase family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*