Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase(apt)

In Stock

Code CSB-BP001954SMT
Product Type Recombinant Protein
Size US$294Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P63546
Lead Time 3-7 business days
Relevance Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of CSB-BP001954SMT could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M1 apt.

  • Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of CSB-BP001954SMT could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M1 apt.

Storage Buffer Tris-based buffer,50% glycerol
Species Streptococcus pyogenes serotype M1
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG
Research Area others
Source Baculovirus
Gene Names apt
Protein Names Recommended name: Adenine phosphoribosyltransferase Short name= APRT EC= 2.4.2.7
Expression Region 1-172aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 22.7kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Subcellular Location Cytoplasm
Protein Families Purine/pyrimidine phosphoribosyltransferase family
Database Links

KEGG: spy:SPy_0927

STRING: 160490.SPy_0927

Related Products

apt Antibodies

apt Antibodies for Escherichia coli O45:K1 (strain S88 / ExPEC)

apt Antibodies for Escherichia coli O157:H7

apt Antibodies for Escherichia coli O157:H7 (strain EC4115 / EHEC)

apt Antibodies for Escherichia coli O8 (strain IAI1)

apt Antibodies for Escherichia coli (strain K12 / DH10B)

apt Antibodies for Escherichia coli O6:K15:H31 (strain 536 / UPEC)

apt Antibodies for Escherichia coli (strain K12)

apt Antibodies for Escherichia coli (strain K12 / MC4100 / BW2952)

apt Antibodies for Escherichia coli (strain 55989 / EAEC)

apt Antibodies for Escherichia coli O81 (strain ED1a)

apt Antibodies for Escherichia coli O9:H4 (strain HS)

apt Antibodies for Escherichia coli (strain SE11)

apt Antibodies for Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

apt Antibodies for Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

apt Antibodies for Escherichia coli O139:H28 (strain E24377A / ETEC)

apt Antibodies for Escherichia coli O7:K1 (strain IAI39 / ExPEC)

apt Antibodies for Escherichia coli O1:K1 / APEC

apt Antibodies for Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

apt Antibodies for Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

apt Antibodies for Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)

apt Antibodies for Escherichia coli (strain SMS-3-5 / SECEC)

apt Antibodies for Escherichia coli O127:H6 (strain E2348/69 / EPEC)

apt Antibodies for Escherichia coli (strain UTI89 / UPEC)

apt Antibodies for Shigella flexneri

apt Proteins

apt Proteins for Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712)

apt Proteins for Nostoc punctiforme (strain ATCC 29133 / PCC 73102)

apt Proteins for Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

apt Proteins for Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)

apt Proteins for Chlorobium phaeobacteroides (strain BS1)

apt Proteins for Rhodopseudomonas palustris (strain TIE-1)

apt Proteins for Burkholderia ambifaria (strain MC40-6)

apt Proteins for Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)

apt Proteins for Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)

apt Proteins for Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) (Burkholderia phytofirmans)

apt Proteins for Methylacidiphilum infernorum (isolate V4) (Methylokorus infernorum (strain V4))

apt Proteins for Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)

apt Proteins for Proteus mirabilis (strain HI4320)

apt Proteins for Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) (Burkholderia phymatum)

apt Proteins for Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.