Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP322729VAA |
| Product Type | Recombinant Protein |
| Size | US$2466 |
| Uniprot No. | P21081 |
| Relevance | The C-terminus binds to and sequesters double-stranded RNA (dsRNA) synthesized during viral infection. This binding acts to 'mask' the dsRNA thereby preventing recognition and subsequent activation of EIF2AK2/PKR. The N-terminus is required for phosphorylation regulation of the translation initiation factor EIF2S1, but without affecting cytosolic protein translation. Blocks the phosphorylation and subsequent activation of IRF3 and IRF7 kinases, that are required for interferon-alpha (IFN-alpha) gene expression. Also inhibits NF-kappa-B activation and the ubiquitin-like protein G1P2/ISG15, which is an early antiviral protein |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Vaccinia virus (strain Copenhagen) (VACV) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | MSKIYIDERSDAEIVCAAIKNIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEADKPDADAMADVIIDDVSREKSMREDHKSFDDVIPAKKIIDWKDANPVTIINEYCQITKRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLLGYVIIRF |
| Research Area | Others |
| Source | E.coli |
| Gene Names | E3L |
| Protein Names | p25 |
| Expression Region | 1-190aa |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Mol. Weight | 28.5 kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | The C-terminus binds to and sequesters double-stranded RNA (dsRNA) synthesized during viral infection. This binding acts to 'mask' the dsRNA thereby preventing recognition and subsequent activation of EIF2AK2/PKR. The N-terminus is required for phosphorylation regulation of the translation initiation factor EIF2S1, but without affecting cytosolic protein translation. Blocks the phosphorylation and subsequent activation of IRF3 and IRF7 kinases, that are required for interferon-alpha (IFN-alpha) gene expression. Also inhibits NF-kappa-B activation and the ubiquitin-like protein G1P2/ISG15, which is an early antiviral protein (By similarity). |
| Protein Families | Poxviridae E3 protein family |
E3L Antibodies for Vaccinia virus (strain Copenhagen) (VACV)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA322729ZA01VAA | E3L Antibody | Vaccinia virus | ELISA, WB (ensure identification of antigen) |
E3L Proteins for Vaccinia virus (strain Copenhagen) (VACV)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP322729VAA CSB-BP322729VAA CSB-MP322729VAA |
Recombinant Vaccinia virus Protein E3 (E3L) | Yeast Baculovirus Mammalian cell |
Recombinant Chicken Homeobox protein engrailed-1(EN1)
Express system: E.coli
Species: Gallus gallus (Chicken)
Recombinant Rat Vascular endothelial growth factor A(Vegfa)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Chitinase-3-like protein 1(CHI3L1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Mannan-binding lectin serine protease 1(MASP1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Prostate stem cell antigen(Psca)
Express system: Yeast
Species: Mus musculus (Mouse)
