Recombinant Vaccinia virus Plaque-size/host range protein(PS/HR),partial

In Stock
Code CSB-EP312446VAI
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q01227
Lead Time 3-7 business days
Storage Buffer Tris-based buffer,50% glycerol
Species Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Purity Greater than 85% as determined by SDS-PAGE.
Sequence YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH
Research Area Others
Source E.coli
Gene Names PS/HR
Protein Names Recommended name: Plaque-size/host range proteinAlternative name(s): Protein B5
Expression Region 18-279aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 33.2 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EV) to allow virion entry into host cells. Participates also in wrapping mature virions (MV) to form enveloped virions (EV).
Subcellular Location Virion membrane, Single-pass type I membrane protein, Virion
Protein Families Receptors of complement activation (RCA) family
Database Links

KEGG: vg:3707658

Related Products

PS/HR Antibodies

PS/HR Antibodies for Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

PS/HR Proteins

PS/HR Proteins for Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.