Recombinant Xenopus laevis Protein Wnt-8(wnt8)

Code CSB-EP340936XBE
Size US$2466 How to order?
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names wnt8
Uniprot No. P28026
Research Area Others
Alternative Names wnt8; Protein Wnt-8; XWnt-8
Species Xenopus laevis (African clawed frog)
Source E.coli
Expression Region 23-358aa
Target Protein Sequence AWSVNNFLMTGPKAYLTYSASVAVGAQNGIEECKYQFAWERWNCPESTLQLATHNGLRSATRETSFVHAISSAGVMYTLTRNCSMGDFDNCGCDDSRNGRIGGRGWVWGGCSDNAEFGERISKLFVDGLETGQDARALMNLHNNEAGRLAVKETMKRTCKCHGISGSCSIQTCWLQLAEFRDIGNHLKIKHDQALKLEMDKRKMRSGNSADNRGAIADAFSSVAGSELIFLEDSPDYCLKNISLGLQGTEGRECLQSGKNLSQWERRSCKRLCTDCGLRVEEKKTEIISSCNCKFHWCCTVKCEQCKQVVIKHFCARRERDSNMLNTKRKNRGHRR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 51.7 kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-B2M-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand for members of the frizzled family of seven transmembrane receptors. Plays a role in ventral mesodermal patterning during embryogenesis. Mimics Nieuwkoop center activity. Causes dorsal mesodermal differentiation of animal cap ectoderm when coexpressed with noggin and nuclear, sequence-specific DNA-binding protein xBra. None of these molecules causes dorsal mesoderm formation when expressed alone.
Gene References into Functions
  1. Data show that Noggin4 fine-tune the Wnt8 posterior-to-anterior gradient. PMID: 26973133
  2. EFHC1 domains are involved in ciliary localization, ciliogenesis, and the regulation of Wnt8a signaling PMID: 26783883
  3. Sulf1 inhibits the ability of Wnt8a to activate the canonical Wnt signalling pathway. PMID: 25681501
  4. study presents the structure of Xenopus Wnt8 (XWnt8) in complex with the mouse Fz8-cysteine-rich domain to a resolution of 3.25 A PMID: 22653731
  5. Xwnt8 directly initiates expression of labial Hox genes. PMID: 19623617
  6. Wnt8 conveyed by Frizzled-related proteins can activate canonical Wnt signalling despite the function of Frizzled-related proteins as Wnt inhibitors, suggesting a novel regulatory system for Wnts by sFRPs PMID: 19906850
  7. by performing gain- and loss-of-function of Wnt signaling experiments, we show that this pathway plays an important role not only in neural crest induction but also in the specification of the neural crest competence territory PMID: 14699582
  8. Wnt8 may stimulate a cellular phosphatase to dephosphorylate and activate CKIepsilon PMID: 14722104
  9. Molecular modeling of the complex between the xWNT8 protein and the CRD domain of mFZD8 PMID: 17506343
  10. Xwnt8-mediated posteriorization is restricted to the eye level and is independent of mesoderm formation. PMID: 18318733
  11. Fgf8a induces neural crest (NC) indirectly through the activation of Wnt8 in the paraxial mesoderm, which in turn promotes NC formation in the overlying ectoderm primed by Bmp antagonists. PMID: 18997112

Show More

Hide All

Subcellular Location Secreted, extracellular space, extracellular matrix.
Protein Families Wnt family
Database Links

KEGG: xla:397970

UniGene: Xl.49

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
X