Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
3 ketoacyl CoA thiolase peroxisomal; 3-ketoacyl-CoA thiolase; ACAA; ACAA1; Acetyl CoA acyltransferase 1; Acetyl Coenzyme A acyltransferase 1; Acetyl-CoA acyltransferase; Acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3 oxoacyl Coenzyme A; Beta ketothiolase; Beta-ketothiolase; Peroxisomal 3 oxoacyl CoA thiolase; Peroxisomal 3 oxoacyl Coenzyme A thiolase; Peroxisomal 3-oxoacyl-CoA thiolase; peroxisomal; PTHIO; THIK_HUMAN; THIO
Species
Homo sapiens (Human)
Expression Region
27-331aa
Target Protein Sequence
LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein of Isoform 2
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Insertion of the gene encoding the Human ACAA1 protein (27-331aa) into a plasmid vector results in the formation of recombinant plasmid, which is then introduced into e.coli cells. Positive e.coli cells are selected relying on their ability to survive in the presence of a specific antibiotic. The e.coli cells containing the recombinant plasmid are cultured under conditions conducive to the expression of the gene of interest. A N-terminal 6xHis-SUMO tag is attached to the protein. Following expression, the recombinant Human ACAA1 protein is isolated and purified from the cell lysate through affinity purification. The resultant recombinant Human ACAA1 protein is analyzed using denaturing SDS-PAGE, revealing a purity greater than 90%.
