Recombinant human Aldehyde oxidase

Code CSB-YP001858HU
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP001858HU-B
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP001858HU
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP001858HU
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
AOX1
Uniprot No.
Research Area
Metabolism
Alternative Names
AOX1; AOAldehyde oxidase; EC 1.2.3.1; Aldehyde oxidase 1; Azaheterocycle hydroxylase; EC 1.17.3.-
Species
Homo sapiens (Human)
Expression Region
236-421aa
Target Protein Sequence
FGSERMMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSRK
Mol. Weight
24.7kD
Protein Length
FAD-binding PCMH-type domain
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Oxidase with broad substrate specificity, oxidizing aromatic azaheterocycles, such as N1-methylnicotinamide, N-methylphthalazinium and phthalazine, as well as aldehydes, such as benzaldehyde, retinal, pyridoxal, and vanillin. Plays a key role in the metabolism of xenobiotics and drugs containing aromatic azaheterocyclic substituents. Participates in the bioactivation of prodrugs such as famciclovir, catalyzing the oxidation step from 6-deoxypenciclovir to penciclovir, which is a potent antiviral agent. Is probably involved in the regulation of reactive oxygen species homeostasis. May be a prominent source of superoxide generation via the one-electron reduction of molecular oxygen. Also may catalyze nitric oxide (NO) production via the reduction of nitrite to NO with NADH or aldehyde as electron donor. May play a role in adipogenesis.
Gene References into Functions
  1. AOX1 SNPs exist in which the base-pair exchange of the SNP leads to loss of enzyme activity. PMID: 26842593
  2. ten novel single nucleotide polymorphisms resulting in amino acid exchanges in proximity to the FAD site of hAOX1, were characterized. PMID: 28750088
  3. Data suggest that substrate specificity of AOX1 includes GDC-0834, an inhibitor of Bruton's tyrosine kinase with potential non-steroidal anti-inflammatory agent activity; in liver cytosol, hydrolysis of GDC-0834 is primarily due to AOX1. PMID: 25845827
  4. Methotrexate is poorly metabolized by human AOX1, in contrast to rabbit. PMID: 26032640
  5. These results supported the possibility that XO/XD and AO can contribute to nitric oxide generation. PMID: 25537183
  6. Several donors have a normal AOX1 protein level. PMID: 23857892
  7. High AOX1 methylation was associated with biochemical recurrence in prostate cancer. PMID: 23918943
  8. The physiological role of AOX1 remains unclear, but it is known that thiopurines belong to its substrates; AOX1 contributes to azathioprine catabolism. PMID: 22495427
  9. hydralazine, at a concentration of 25 to 50 muM, can be used in human hepatocyte incubations to estimate the contribution of aldehyde oxidase to the hepatic clearance of drugs and other compounds. PMID: 22522748
  10. Human population is characterized by the presence of functionally inactive hAOX1 allelic variants as well as variants encoding enzymes with different catalytic activities. PMID: 22279051
  11. characterization of AO activity in cryopreserved human hepatocytes: enzyme stability; substrate specificity; kinetics; inhibition by hydralazine PMID: 22031625
  12. Expressed AOX1 in Escherichia coli and purified kinetically active protein. PMID: 19741035

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Xanthine dehydrogenase family
Tissue Specificity
Abundant in liver, expressed in adipose tissue and at lower levels in lung, skeletal muscle, pancreas. In contrast to mice, no significant gender difference in AOX1 expression level (at protein level).
Database Links

HGNC: 553

OMIM: 602841

KEGG: hsa:316

STRING: 9606.ENSP00000363832

UniGene: Hs.406238

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X