Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
3; 4; 5)-tetrakisphosphate 3-phosphatase; 5)P(4) 3-phosphatase; DKFZp564L2016; HIPER1; Inositol (1; inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase; Ins(1; ins(1,3,4,5)P(4) 3-phosphatase; MINP1_HUMAN; Minpp1; MINPP2; MIPP; Multiple inositol polyphosphate histidine phosphatase, 1; Multiple inositol polyphosphate phosphatase 1; multiple inositol polyphosphate phosphatase 2
Species
Homo sapiens (Human)
Expression Region
31-487aa
Target Protein Sequence
SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Human MINPP1 covers amino acids 31-487. The calculated molecular weight for this MINPP1 protein is 54.1 kDa. The MINPP1 protein was expressed in yeast. The MINPP1 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant MINPP1 protein during the following stages.
Human multiple inositol polyphosphate phosphatase 1 (MINPP1) is a phosphatase enzyme that catalyzes the dephosphorylation of inositol polyphosphates, specifically targeting inositol hexakisphosphate (InsP6) and inositol pentakisphosphate (InsP5). MINPP1 is involved in the homeostasis of inositol polyphosphates, which are signaling molecules implicated in various cellular processes, including cell growth, vesicle trafficking, and ion channel regulation. Dysregulation of inositol polyphosphate metabolism, including alterations in MINPP1 activity, has been associated with certain diseases, including cancer and neurodegenerative disorders. Research on MINPP1 contributes to the understanding of inositol signaling pathways and their impact on cellular physiology.
