Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

MINPP1

Uniprot No.

Q9UNW1

Research Area

Signal Transduction

Alternative Names

3; 4; 5)-tetrakisphosphate 3-phosphatase; 5)P(4) 3-phosphatase; DKFZp564L2016; HIPER1; Inositol (1; inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase; Ins(1; ins(1,3,4,5)P(4) 3-phosphatase; MINP1_HUMAN; Minpp1; MINPP2; MIPP; Multiple inositol polyphosphate histidine phosphatase, 1; Multiple inositol polyphosphate phosphatase 1; multiple inositol polyphosphate phosphatase 2

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

31-487aa

Target Protein Sequence

SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

54.1kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Human MINPP1 covers amino acids 31-487. The calculated molecular weight for this MINPP1 protein is 54.1 kDa. The MINPP1 protein was expressed in yeast. The MINPP1 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant MINPP1 protein during the following stages.

Human multiple inositol polyphosphate phosphatase 1 (MINPP1) is a phosphatase enzyme that catalyzes the dephosphorylation of inositol polyphosphates, specifically targeting inositol hexakisphosphate (InsP6) and inositol pentakisphosphate (InsP5). MINPP1 is involved in the homeostasis of inositol polyphosphates, which are signaling molecules implicated in various cellular processes, including cell growth, vesicle trafficking, and ion channel regulation. Dysregulation of inositol polyphosphate metabolism, including alterations in MINPP1 activity, has been associated with certain diseases, including cancer and neurodegenerative disorders. Research on MINPP1 contributes to the understanding of inositol signaling pathways and their impact on cellular physiology.

Target Background

Function

Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Also acts as a 2,3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2,3-bisphosphoglycerate (2,3-BPG) to produce phospho-D-glycerate without formation of 3-phosphoglycerate. May play a role in bone development (endochondral ossification). May play a role in the transition of chondrocytes from proliferation to hypertrophy.

Gene References into Functions

Minpp1 exhibits characteristics of a stress responsive molecule during Endoplasmic reticulum stress-induced apoptosis PMID: 27038811
By RNA knockdown, we identified secreted and lysosome targeted MINPP1 (multiple inositol-polyphosphate phosphatase 1), the mammalian 3-phytase, to be essentially involved both in extracellular and in lysosomal InsP6 dephosphorylation PMID: 23186306

Involvement in disease

Thyroid cancer, non-medullary, 2 (NMTC2)

Subcellular Location

Endoplasmic reticulum lumen.

Protein Families

Histidine acid phosphatase family, MINPP1 subfamily

Tissue Specificity

Widely expressed with highest levels in kidney, liver and placenta.

Database Links

HGNC: 7102

OMIM: 188470

KEGG: hsa:9562

STRING: 9606.ENSP00000361064

UniGene: Hs.121260

Code	CSB-YP891977HU
Abbreviation	Recombinant Human MINPP1 protein
MSDS	MSDS Datasheet
Size	$250
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant human Multiple inositol polyphosphate phosphatase 1 (MINPP1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage