Recombinant human TRAF family member-associated NF-kappa-B activator

Code CSB-BP023116HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023116HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP023116HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
I TRAF; I-TRAF; ITRAF; Tank; TANK_HUMAN; TRAF family member associated NF KAPPA B activator; TRAF family member associated NFKB activator; TRAF family member-associated NF-kappa-B activator; TRAF interacting protein; TRAF interacting protein TANK isoform a; TRAF interacting protein TANK isoform b; TRAF-interacting protein; TRAF2
Species
Homo sapiens (Human)
Expression Region
1-119aa
Target Protein Sequence
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVDIASAESSI
Mol. Weight
41kD
Protein Length
Partial of the full length of 1-425aa
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Adapter protein involved in I-kappa-B-kinase (IKK) regulation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regulator of TRAF function by maintaining them in a latent state. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. Negatively regulates NF-kappaB signaling and cell survival upon DNA damage. Plays a role as an adapter to assemble ZC3H12A, USP10 in a deubiquitination complex which plays a negative feedback response to attenuate NF-kappaB activation through the deubiquitination of IKBKG or TRAF6 in response to interleukin-1-beta (IL1B) stimulation or upon DNA damage. Promotes UBP10-induced deubiquitination of TRAF6 in response to DNA damage. May control negatively TRAF2-mediated NF-kappa-B activation signaled by CD40, TNFR1 and TNFR2.
Gene References into Functions
  1. Therefore, Seneca Valley virus suppressed antiviral interferon production to escape host antiviral innate immune responses by cleaving host adaptor molecules MAVS, TRIF, and TANK by its 3C protease. PMID: 28566380
  2. Data suggest that Encephalomyocarditis virus 3C protease cleaves TANK and disrupts the TANK-TBK1-IKKepsilon-IRF3 complex, resulting in reduction in IRF3 phosphorylation and type I interferon production. (TANK = TRAF family member associated NFKB activator; TBK1 = TANK binding kinase 1; IKKepsilon = inhibitor of nuclear factor kappa B kinase subunit epsilon; IRF3 = interferon regulatory factor 3) PMID: 28487378
  3. Molecular basis for TANK recognition by TRAF1 revealed by the crystal structure of TRAF1/TANK complex has been reported. PMID: 28155233
  4. these results suggest that TANK is a novel target of some viral proteases, indicating that some positive RNA viruses have evolved to utilize their major proteases to regulate NF-kappaB activation. PMID: 26363073
  5. TANK serves as an important negative regulator of NF-kappaB signaling cascades induced by genotoxic stress and IL-1R/Toll-like receptor stimulation in a manner dependent on MCPIP1/USP10-mediated TRAF6 deubiquitination. PMID: 25861989
  6. Two SNPs in TANK (rs17705608 and rs7309) were significantly associated with breast cancer risk in our study sample. PMID: 23634849
  7. two TANK gene polymorphisms (rs1921310, rs3820998) do not play a significant role in pathogenesis of chronic periodontitis or peri-implantitis among the Iranian population PMID: 23428248
  8. Studies show that three proteins expressed in HEK-293T cells (NAP1, TANK and TBKBP1) interact with TBK1. PMID: 23286385
  9. TANK plays a role in the pathogenesis of acute-on-chronic hepatitis B liver failure (ACLF-HBV) patients and liver cirrhosis patients. PMID: 22225470
  10. MARCH5 is an authentic E3 ubiquitin ligase and catalyzes K63-linked polyubiquitination of TANK. MARCH5 modulates TLR7 signaling via releasing the inhibitory action of TANK toward TRAF6. PMID: 21625535
  11. SUMO modification of TANK alleviates its repression of TLR7 signalling PMID: 21212807
  12. Expression of TRF2 and TANK1 increased in monoclonal gammopathy of undetermined significance and multiple myeloma. PMID: 20644899
  13. These findings reveal that the scaffold protein TANK recruits PLK1 to negatively regulate NF-kappaB activation and provide direct evidence that PLK1 is required for the repression function of TANK. PMID: 20484576
  14. association with I kappa B kinase (IKK) regulator NEMO connects IKK complexes with IKK epsilon and TBK1 kinases PMID: 12133833
  15. codominant effect of the relevant haplotype of I-TRAF gene in determination of radial bone mineral density PMID: 14499357
  16. LTbetaR, CD40 and TANK interact with TRAF3 at sites that promote molecular interactions driving specific signaling PMID: 14517219
  17. the scaffold protein TANK is required for the cellular response to TNFalpha by connecting upstream signalling molecules to the IKKs and p65 PMID: 16336209
  18. TANK may be a critical adaptor that regulates the assembly of the TANK-binding kinase 1-inducible IkappaB kinase complex with upstream signaling molecules in multiple antiviral pathways PMID: 17327220
  19. results suggest that efficient signal transduction upon viral infection requires SINTBAD, TANK and NAP1 because they link TBK1 and IKKi to virus-activated signalling cascades PMID: 17568778
  20. Lipopolysaccharide-mediated interferon regulatory factor activation involves TBK1-IKKepsilon-dependent Lys(63)-linked polyubiquitination and phosphorylation of TANK/I-TRAF. PMID: 17823124

Show More

Hide All

Subcellular Location
Cytoplasm.
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 11562

OMIM: 603893

KEGG: hsa:10010

STRING: 9606.ENSP00000259075

UniGene: Hs.132257

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1