Recombinant Human Talin-2 (TLN2), partial, partial

Code CSB-BP897282HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP897282HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP897282HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
TLN2
Uniprot No.
Research Area
Signal Transduction
Alternative Names
DKFZp451B1011; DKFZp686I0976; DKFZp686K0979; ILWEQ; KIAA0320; Talin-2; talin2; TLN 2; TLN2; TLN2_HUMAN
Species
Homo sapiens (Human)
Expression Region
88-406aa
Target Protein Sequence
RPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKK
Mol. Weight
53.1kD
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
As a major component of focal adhesion plaques that links integrin to the actin cytoskeleton, may play an important role in cell adhesion. Recruits PIP5K1C to focal adhesion plaques and strongly activates its kinase activity.
Gene References into Functions
  1. The central role of talin and vinculin in cell adhesions suggests that the disintegration of the tissue in atherosclerosis could be partially driven by downregulation of these genes, leading to loosening of cell-ECM interactions and remodeling of the tissue. PMID: 27816808
  2. These results suggest that a strong interaction of talin2 with integrins is required to generate traction, which in turn drives invadopodium-mediated matrix degradation, which is key to cancer cell invasion. PMID: 27694340
  3. data suggest a potential molecular link between TLN2 and camptodactyly pathogenesis. PMID: 27223613
  4. Both TLN-1 and TLN-2 levels correlate with tumorigenicity in human HCC, indicating that these molecules constitute important molecular targets for the diagnosis and/or treatment of hepatocellular carcinoma . PMID: 26822056
  5. Data indicate the role of vinculin in inducing the talin mediated integrin activation. PMID: 24446374
  6. Talin1 has unique expression versus talin 2 in the heart and modifies the hypertrophic response to pressure overload. PMID: 23266827
  7. Data show that SCGB3A1 was down-regulated in invasive compared with DCIS, whereas talin 2 (TLN2) and PTGS1 were up-regulated in invasive compared with DCIS. PMID: 21812955
  8. This review discusses the general function of talin 1 and talin 2, as well as vinculin/metavinulin, with emphasis on what is understood about their role in the cardiac myocyte and in whole heart. PMID: 19952892
  9. Structural diversity in integrin/talin interactions. PMID: 21134644
  10. the differential concentration of CSF and serum-talin 2 in the drug-refractory postencephalitic epilepsy group is an intractability-related phenomenon that might be involved in the development of RPEE PMID: 20620133
  11. we show that the predominant brain splice variant of PtdInsPKI gamma (PtdInsPKI gamma-90) binds, by means of a short carboxy-terminal peptide, to the FERM domain of talin, and is strongly activated by this interaction PMID: 12422219
  12. The F-actin binding capacity of Talin 2 is regulated by intrasteric occlusion of primary actin-binding determinants within the talin I/LWEQ module. PMID: 15581353
  13. Talin2 may serve as the link between integrins and the sarcomeric cytoskeletonin stable adhesion complexes in mature striated muscle. PMID: 17183545
  14. Data show that TLN2n presents only in the CSF of temporal lobe epilepsy patients. PMID: 19109932

Show More

Hide All

Subcellular Location
Cytoplasm. Cell junction, focal adhesion. Cell junction, synapse. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton.
Database Links

HGNC: 15447

OMIM: 607349

KEGG: hsa:83660

STRING: 9606.ENSP00000303476

UniGene: Hs.569438

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1