Recombinant Arabidopsis thaliana Alternative oxidase 1a, mitochondrial (AOX1A)

Code CSB-CF655106DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
AOX1A
Uniprot No.
Alternative Names
AOX1A; AOX1; HSR3; At3g22370; MCB17.11; Ubiquinol oxidase 1a, mitochondrial; Alternative oxidase 1a
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
63-354
Target Protein Sequence
ASTITLGEKTPMKEEDANQKKTENESTGGDAAGGNNKGDKGIASYWGVEPNKITKEDGSE WKWNCFRPWETYKADITIDLKKHHVPTTFLDRIAYWTVKSLRWPTDLFFQRRYGCRAMML ETVAAVPGMVGGMLLHCKSLRRFEQSGGWIKALLEEAENERMHLMTFMEVAKPKWYERAL VITVQGVFFNAYFLGYLISPKFAHRMVGYLEEEAIHSYTEFLKELDKGNIENVPAPAIAI DYWRLPADATLRDVVMVVRADEAHHRDVNHFASDIHYQGRELKEAPAPIGYH
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the cyanide-resistant oxidation of ubiquinol and the reduction of molecular oxygen to water, but does not translocate protons and consequently is not linked to oxidative phosphorylation. Increases respiration when the cytochrome respiratory pathway is restricted, or in response to low temperatures.
Gene References into Functions
  1. AOX1A activation by Tricarboxylic acid cycle Intermediates 2-oxoglutarate and oxaloacetate. PMID: 29208641
  2. AOX isoforms are differentially activated and that activation at CysI and CysII is additive. PMID: 28596420
  3. MYB DOMAIN PROTEIN29 (MYB29) mutants have increased levels of ALTERNATIVE OXIDASE1a (AOX1a) transcript and protein compared to wild type after induction with antimycin A. PMID: 28167700
  4. Overexpression of AOX1a rescued the aox1a mutant phenotype, including the chlorophyll accumulation during greening and plastidial protein import. PMID: 25158995
  5. Phosphate deprivation increased NO production in WT roots, and the AOX level and the capacity of the alternative pathway to consume electrons in WT seedlings. PMID: 26163703
  6. AOX1A plays a significant role in sustaining the chloroplastic redox state and energization to optimize photosynthesis by regulating cellular redox homeostasis and ROS generation when electron transport through the COX pathway is disturbed at complex III. PMID: 26292995
  7. The authors propose a working model where AOX1a acts early in the response to Cd and activates or maintains a mitochondrial signalling pathway impacting on cellular antioxidative defence at the post-transcriptional level. PMID: 25743159
  8. RAO2/Arabidopsis NAC domain-containing protein17 (ANAC017) as a direct positive regulator of AOX1a. Plants with mutated rao2/anac017 were more stress sensitive. PMID: 24045017
  9. Arabidopsis plants deficient in AOX1a were unable to sustain photosynthesis under high light as is the case in WT plants. PMID: 24560882
  10. Overexpression of AOX1a reduced mitochondrial ROS production by maintaining the mitochondrial electron flux, and alleviated subsequent mitochondrial dysfunction and caspase-3-like activation in Al-induced programmed cell death. PMID: 24863436
  11. Foliar NO3 (-) assimilation was enhanced in both aox1a and ucp1 compared with the wild-type, suggesting that foliar NO3 (-) assimilation is probably driven by a decreased capacity of mAET and an increase in reductant within the cytosol. PMID: 24799562
  12. AOX and CET-PSI participate together in optimizing plant growth under conditions with elevated light intensity. [AOX1A] PMID: 21707657
  13. These results indicate that AOX is important for optimizing rates of photosynthetic CO(2) assimilation in response to rising CO(2) concentration. PMID: 22848123
  14. The ability of AOX1a and AOX2 to substitute for PTOX in the correct physiological and developmental contexts is a striking example of the capacity of a mitochondrial protein to replace the function of a chloroplast protein. PMID: 22534126
  15. These results suggest that AOX plays an important role in rapid acclimation of the respiratory chain to sHL, which may support efficient photosynthetic performance. PMID: 21251020
  16. When aox1a mutant seedlings were grown under a high-light condition, photobleaching was more evident in the mutant than the wild-type plants. PMID: 20716069
  17. AOX can play a critical role in cell re-programming under salinity stress. PMID: 19941623
  18. A 93 base pair portion necessary for induction was identified in the AtAOX1a promoter. PMID: 16027972
  19. AOX not only functions to prevent excess reactive oxygen species formation in whole tissues under stressful environmental conditions but also affects metabolism through more pervasive effects, including some that are extramitochondrial. PMID: 16299170
  20. a microarray study using an anti-sense line showed AOX1a influences outside mitochondria, particularly in chloroplasts and on several carbon metabolism pathways PMID: 16299171
  21. A variety of Cys(II) substitutions constitutively activated AtAOX1a, indicating that neither the catalytic site nor, unlike at Cys(I), charge repulsion is involved. PMID: 16457775
  22. AOX1a plants have a greatly altered stress response even when mitochondria or the mitochondrial electron transport chain are not the primary target of the stress and that AOX1a plays a broad role in determining the normal redox balance in the cell PMID: 18424626
  23. AOX is a necessary component in antioxidant defence mechanisms and for the control of a balanced metabolism. PMID: 18507803

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Note=Mitochondrial, possibly in the inner surface of the inner mitochondrial membrane.
Protein Families
Alternative oxidase family
Tissue Specificity
Expressed in roots, stems, cotyledons, leaves and flowers. High expression in sepals.
Database Links

KEGG: ath:AT3G22370

STRING: 3702.AT3G22370.1

UniGene: At.23475

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1