Recombinant Bovine B-cell antigen receptor complex-associated protein alpha chain(CD79A)

Code CSB-CF004957BO
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names CD79A
Uniprot No. P40293
Alternative Names CD79A; IGA; MB-1B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha; MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD antigen CD79a
Species Bos taurus (Bovine)
Expression Region 32-223
Target Protein Sequence LWVEWGPPSVTVSVGEEVRLQCTHNGSNTNVTWWHVLQSNSSWPPVMYRGDVGAGGELIIKPVNKTHRGMYRCQVSDGKKIQRSCGTYLRVRDPLPRPFLDMGEGTKNNIITAEGIILLICAVVPGTLLLFRKRWQNMKFGADIQDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLHIGDAQLEKP
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells (By similarity).
Subcellular Location Cell membrane, Single-pass type I membrane protein
Tissue Specificity B-cells.
Database Links

KEGG: bta:281674

STRING: 9913.ENSBTAP00000002451

UniGene: Bt.4436

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1