Recombinant Chicken Smoothened homolog(SMO)

Code CSB-CF021841CH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O42224
Storage Buffer Tris-based buffer,50% glycerol
Species Gallus gallus (Chicken)
Sequence PRRCPAAPLNASAAPPERCRRPAACERLRFGSCLGSALPYAHTSTLLAADSGSQEEAHGK LLLWSGLRNAPRCWDVIQPLLCAVYMPKCEDGQVELPSQTLCQATRAPCTIVERERGWPD FLKCTPDRFPEGCPNEVQNIKFNSSGQCEAPLVRTYNPKSWYEDVEGCGIQCQNPLFTET EHREMHVYIAFSSVTISCTFFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGCVAQFM DGARDEIVCRADGTMRLGEPTSNETLSCVIIFVIVYYSLMSGVIWFVMLTYAWHTSFKAL GTTYQPLLGKTSYFHLITWSIPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLA PIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVFIT FGCHFYDFFNQAEWERSFREYVLCEANVTIATQTNKPIPECEIKNRPSLLVEKINLFAMF GTGISMSTWVWTKATLLIWKRTWCRLTGQSDDQPKRIKKSKMIAKAFSKRKELLRDPGRE LSFSMHTVSHDGPVAGLAFDINEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPV PPEERSNLWVVEADVSPELQKRSRKKKRRKKKKEEVCPERRAGLSVAPLTPSSVPRLPRL PQQPCLVAIPRHRGDTFIPTVLPGLSNGAGGLWDGRRRAHVPHFITNPFCPESGSPEDEE NPGPSVGHRQHNGGRRWPPEPLPGGSGVTRTRGRRAGLAPIHSRTNLVNAELLDADLDF
Source in vitro E.coli expression system
Gene Names SMO
Protein Names Recommended name: Smoothened homolog Short name= SMO
Expression Region 16-794
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function G protein-coupled receptor that probably associates with the patched protein (PTCH) to transduce the hedgehog's proteins signal. Binding of sonic hedgehog (SHH) to its receptor patched is thought to prevent normal inhibition by patched of smoothened (SMO).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor Fz/Smo family
Database Links

UniGene: Gga.4082

Pathway Hedgehog signaling pathway

Related Products

SMO Proteins

SMO Proteins for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.