Recombinant Danio rerio Gap junction alpha-1 protein (gja1)

Code CSB-CF009443DIL
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
gja1; cx43; shf; sof; Gap junction alpha-1 protein; Connexin-43; Cx43; Short fin protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Expression Region
2-381
Target Protein Sequence
GDWSALGRLLDKVQAYSTAGGKVWLSVLFIFRILVLGTAVESAWGDEQSAFKCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSTPTLLYLAHVFYLMRKEEKLNRKEEELKAVQNDGG DVELHLKKIELKKFKHGLEEHGKVKMKGSLLRTYIFSIIFKSICEVVFLVIQWYLYGFSL SAVYTCERTPCPHRVDCFLSRPTEKTIFIIFMLVVSLFSLLLNIIELFYVLFKRIKDRVK SRQNTQFPTGTLSPTPKELSTTKYAYYNGCSSPTAPLSPMSPPGYKLATGERTNSCRNYN KQANEQNWANYSTEQNRLGQNGSTISNSHAQAFDYPDDTHEHKKLTPGHELQPLALIDAR PCSRASSRMSSRARPDDLDV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Plays an essential role in gap junction communication in the ventricles.; Plays a role in regulation of fin bone size and growth.
Gene References into Functions
  1. Data show that Connexin43 (Cx43) was identified as the gene causing the short-of-fin (sof) phenotype, in which the fin ray segments are shorter but the vertebrae are normal. PMID: 27129238
  2. serpinh1b is molecularly and functionally downstream of cx43. The gene serpinh1b codes for a protein called Hsp47, a molecular chaperone responsible for proper folding of procollagen molecules. PMID: 26103547
  3. Hapln1a-ECM stabilizes the secreted growth factor Semaphorin3d (Sema3d), which has been independently shown to mediate Cx43 dependent phenotypes during regeneration. PMID: 26828861
  4. Hapln1a has a critical role in connexin43-dependent growth and patterning in the regenerating fin skeleton PMID: 24533114
  5. increased expression in Dupuytren's disease PMID: 24359029
  6. Sema3d functions in a common molecular pathway with Cx43 cell proliferation and joint formation PMID: 22542598
  7. Data show that the cultured fibroblasts from patients with ossification of the posterior longitudinal ligament (OPLL) exhibited osteogenic characteristics, in which Cx43 played an important role. PMID: 21311398
  8. Studies indicate that Cardiomyogenesis is determined by stimuli from the cellular microenvironment, where connexin43 may play an important role. PMID: 21931658
  9. Data demonstrate a cross-talk between IGF-1R and AT-1R in AT-II and IGF-1-induced Cx43 expression in SV SMCs involving Erk 1/2 and downstream activation of the AP-1 transcription factor. PMID: 20731749
  10. These results of this study suggested that alterations of astrocyte connexins might be involved in the suicide process and provide further evidence implicating astrocytes in psychopathology. PMID: 21571253
  11. Gap junctional intercellular communication in human bladder smooth muscle cells and suburothelial myofibroblastsdepend of Cx43 rather than on Cx45. PMID: 21674053
  12. Critical role of connexin43 in zebrafish late primitive and definitive hematopoiesis. PMID: 20020200
  13. Cx43 is crucial for TJ reassembly at the blood-testis barrier during its cyclic restructuring throughout the seminiferous epithelial cycle of spermatogenesis PMID: 20921394
  14. Neonatal murine atrial myocytes showed similar abundances of Cx40 and Cx43 proteins, while ventricular myocytes contained at least 20 times more Cx43 than Cx40. PMID: 19486903
  15. There was a lack of membranous distribution of connexins or a shift from moderately membranous immunoreactivity to predominantly cytoplasmic accumulation of CX32 and CX43 in studied colon tumors. PMID: 20133984
  16. Cx48.5, Cx44.1, Cx43 have roles in lens development PMID: 14648847
  17. The fin length mutant short fin (sof), which causes defects in the length of bony fin ray segments, is caused by mutations in the connexin43 (cx43) gene. PMID: 15649473
  18. molecular cloning; Cx43alpha1 gap junctions are likely to have conserved roles in vertebrate embryonic development PMID: 15895415
  19. Measurable differences in Cx43 function may be correlated with the severity of defects in bone length. PMID: 17599838
  20. Connexin43 (GJA1) is required in the population of dividing cells during fin regeneration. PMID: 18406403
  21. Results reveal a correlation between the level of Cx43 expression in the fin ray mesenchyme and the location of joints in developing zebrafish. PMID: 19150347
  22. role of Cx43.4 appears to be conserved given that its ortholog, human Cx45, is able to functionally compensate for zebrafish Cx43.4 during L-R patterning PMID: 19799895

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Alpha-type (group II) subfamily
Tissue Specificity
Expressed in adult ovary, heart, lens and liver. In growing caudal fins, expressed in cells flanking the germinal region of newly growing segments and in osteoblasts at segment boundaries.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1