Recombinant Dog Cyclic nucleotide-gated cation channel beta-3 (CNGB3)

Code CSB-CF850746DO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CNGB3; Cyclic nucleotide-gated cation channel beta-3; Cone photoreceptor cGMP-gated channel subunit beta; Cyclic nucleotide-gated cation channel modulatory subunit; Cyclic nucleotide-gated channel beta-3; CNG channel beta-3
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Expression Region
1-782
Target Protein Sequence
MFKSLTIKSNKVKPREENDENKQDPDPSNQPQQSTRQGENKSENKSLQTKMTPVTFEESH AKMQDKISEKNSLRDLTTNPNHQHPTESKGAMSEQKEMETGKEGLVSPKSKPLGVPVINE YADAQLHNLVRRMRQRTMLYKKKLAEGDISSPEASPQTAKPTAVPSTQESNAKLKEEHYY HILCFKFQKMPLTEYLKRFRLPGSIDSYTDRLYLLWLLLVTIAYNWNCWLIPLRLVFPYQ TPDNTHYWFITDITCDIIYLCDMLLIQPRLQFIKGGDIMVDSNELKRHYRSSTKFQLDVA SVMPFDVFYLFFGFNPVFRMNRILKYTSFFEFNHHLESIMDKAYIYRVIRTTGYLLYTLH INACIYYWASDYEGIGSTKWVYNGEGNKYLRCYYWAVRTLITIGGLPEPQTSFEIVFQLL NFFSGVFVFSSLIGQMQDVIGAATANQNNFRISMDHTISYMNTYSIPKNVQNRVRTWYEY TWDSQRMLDESDLLCTLPVTMQLALTVDVNLSIISKVELFKGCDTQMIYDMLLRLKSTVY LPGDFVCKKGEIGKEMYIIKQGEVQVLGGSDGAQVLVTLKAGAVFGEISLLAGRGGNRRT ANVIAHGFANLLTLDKKTLQEILVHYPDSEKLLMKKASVLLKKKAPATETTPPRKGLAFL FPPKQETPKIFKALLGGTGKAGLTRLLKLKREQTIQKTSENSEEGGGKRREYEDKEREPS EKILDSSECRANCIIAEEMPQSIRRAALPRGTTRQSLIISMAPSAEAGEEVLTIEVKEKA KQ
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cGMP which leads to an opening of the cation channel and thereby causing a depolarization of rod photoreceptors. Induced a flickering channel gating, weakened the outward rectification in the presence of extracellular calcium, increased sensitivity for L-cis diltiazem and enhanced the cAMP efficacy of the channel when coexpressed with CNGA3. Essential for the generation of light-evoked electrical responses in the red-, green- and blue sensitive cones.
Gene References into Functions
  1. Missense mutation at position 262 in the canine CNGB3 (D262N) subunit results in loss of cone function (daylight blindness), suggesting an important role for this aspartic acid residue in channel biogenesis. PMID: 24586388
  2. Day blindness shows genetic heterogeneity within the CNGB3 gene of the Alaskan Malamute population of Australia. PMID: 16879359
Involvement in disease
Defects in CNGB3 are a cause of cone degeneration (cd). Cd is characterized by day-blindness and absence of retinal cone function. This autosomal recessive disorder occurs naturally in the Alaskan Malamute and German Shorthaired Pointer breeds.
Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family, CNGB3 subfamily
Database Links

KEGG: cfa:403554

STRING: 9615.ENSCAFP00000036190

UniGene: Cfa.72

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×