Recombinant Dog Cytochrome c oxidase subunit 2 (MT-CO2)

Code CSB-CF015073DO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Expression Region
1-227
Target Protein Sequence
MAYPFQLGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETVWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTQELKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMAMRPGLYYGQCSEICGSNHSFMPIVLEMVPLSYFETWSALMV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Gene References into Functions
  1. high expression in mast cell tumours associated with proliferation, angiogenesis and decreased survival PMID: 28467670
  2. gene expression of COX-2 and prostaglandin E synthase may be involved in the regulation of patency in the uterine cervix of bitches with pyometra PMID: 26596635
  3. The present results suggest that the COX-2(+)/EGFR(+) status may be part of a strategy adopted by tumor cells to evade the cytotoxic tumor-specific immune responses PMID: 25964576
  4. COX-2 was expressed 141-fold more in canine osteosarcoma cancer stem cell spheres than daughter adherent cells. PMID: 24416158
  5. These results confirm that COX-2 is expressed in the neoplastic glandular epithelial cells in canine anal sac adenocarcinoma (ASAC) and suggest a potential role for COX-2 inhibitors in the management of ASAC. PMID: 23778258
  6. In the gliomas reported in this study, none expressed COX2; none were immunoreactive for c-kit, although all three high-grade tumours had intramural vascular expression. PMID: 22235799
  7. COX-2 is expressed at high level in osteosarcoma and support the use of COX-2 inhibitors to improve the response to chemotherapy. PMID: 22633646
  8. Renal COX-2 is induced in canine and feline CKD, especially in relation to the glomerular changes; no significant correlations were found for COX-1 PMID: 22244709
  9. mutations in the Cox-2 gene could be the cause of renal dysplasia in dogs PMID: 21346820
  10. This study evaulated neoplastic cyclooxygenase-2 expression in correlation with other neoplasm traits such as: histological type, the differentiation grade, proliferative activity, estrogenic receptor, as well as Hsp70 and p53 proteins expression. PMID: 20731190
  11. Investigation of prognostic value of COX2 in prognosis of dog malignant mammry tumors. PMID: 19939424
  12. Inhibition of COX-2 improves transplanted cardiac function following long-term preservation. PMID: 16713604
  13. These results demonstrate a new function for TonEBP/NFAT5, i.e., to mediate hypertonic-induced COX2 expression, and suggest that osmoprotection strongly depends on COX2 protein levels. PMID: 19146830
  14. COX-2 expression in canine normal and neoplastic mammary gland is reported. PMID: 19203768

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Cytochrome c oxidase subunit 2 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1