Recombinant Escherichia coli Hemolysin E, chromosomal (hlyE)

Code CSB-CF303529ENV
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
hlyE
Uniprot No.
Alternative Names
hlyE; clyA; hpr; sheA; ycgD; b1182; JW5181; Hemolysin E, chromosomal; Cytotoxin ClyA; Hemolysis-inducing protein; Latent pore-forming 34 kDa hemolysin; Silent hemolysin SheA
Species
Escherichia coli (strain K12)
Expression Region
2-303
Target Protein Sequence
TEIVADKTVEVVKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASVL VGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVLD DGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGA AAGVVAGPFGLIISYSIAAGVVEGKLIPELKNKLKSVQNFFTTLSNTVKQANKDIDAAKL KLTTEIAAIGEIKTETETTRFYVDYDDLMLSLLKEAAKKMINTCNEYQKRHGKKTLFEVP EV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Toxin, which has some hemolytic activity towards mammalian cells. Acts by forming a pore-like structure upon contact with mammalian cells.
Gene References into Functions
  1. Membrane-triggered conformational transition of ClyA has been caprured and reported. PMID: 27797514
  2. The assembly dynamics of the cytolytic pore toxin ClyA has been reported. PMID: 25652783
  3. These findings show that the clyA+ locus is expressed at an elevated level in the uropathogenic Escherichia coli strain and the authors conclude that this is at least in part due to the effect of the SfaX/PapX transcriptional regulators. PMID: 25178918
  4. ClyA is delivered to the target host cell in an oligomeric conformation within outer membrane vesicles (OMVs), our findings suggest ClyA forms a prepore oligomeric structure independently of the lipid membrane within the OMV. PMID: 24019520
  5. Novel site(s) in HlyB responsible for enhancing secretion of cyclodextrin glucanotransferase in E. coli. PMID: 20959127
  6. in extraintestinal Escherichi coli infections, no HylaA+ sheA+ strains were identified, suggesting possible incompatibility between HlyA and SheA in the chromosome of E. coli PMID: 15956433
  7. analysis of the hemolysin E (HlyE, ClyA, and SheA) channel in its membrane-bound form PMID: 16754675
  8. Data Show that hlyE expression in Escherichia coli was controlled by alternate SlyA and H-NS nucleoprotein complexes. PMID: 17892462
  9. Circular dichroism and fluorescence energy transfer analyses show that HlyE protomers retain an alpha-helical structure when oligomerized to form a pore consisting of parallel HlyE protomers. PMID: 18227266
  10. results failed to show a positive correlation with SIDS, instead proving that clyA and irp2 genes were common to the infant intestinal E. coli PMID: 19208875

Show More

Hide All

Subcellular Location
Secreted. Periplasm. Host cell membrane; Single-pass membrane protein. Note=Exported from the cell by outer membrane vesicles. Also found in the periplasmic space.
Protein Families
Hemolysin E family
Database Links

KEGG: ecj:JW5181

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1