Recombinant Horse Interleukin-7 receptor subunit alpha(IL7R)

Code CSB-CF011670HO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A0MSX9
Storage Buffer Tris-based buffer,50% glycerol
Species Equus caballus (Horse)
Sequence ESGYAQNGDFEDAELDDYSFSCYSQLEVDGPQHLLSCAFEDPDVNSTNLEFEICEGLLEVKCLNFSKLQETYFIKTKKFLLIGDSTICVKLGGKHITCQKLNIVKRVKPEAPFDVKVIYREEANEFVVTFNTSHLQKKYVKDLLHEVVYRLEKNENDWMHVNISSTKLTLLQRKLQPNAMYEIKVRSIPNTNYFEGFWSEWSPSSHFRTPENNSGKMDPVLLIISIVSFFSVALMVILACVLWKKRIKPIVWPSLPDHKKTLEQLCKKPKKNLNVSFNPESFLDCQIHKVDGIQARDEAEAFLQDTFPPQLDDSEKQRLGGGVQGLNWPSQHAVITPKTFGGESPLRCLSGSVTVCDVPVIPSSRPPDCREGGKNGPHVYQGLLLGAGTTNSTLPHLFPFQSGILTLNPAVQGQPLFTSLGSSQEEAYVTMSSFYQNQ
Source in vitro E.coli expression system
Gene Names IL7R
Protein Names Recommended name: Interleukin-7 receptor subunit alpha Short name= IL-7 receptor subunit alpha Short name= IL-7R subunit alpha Short name= IL-7R-alpha Short name= IL-7RA Alternative name(s): CD_antigen= CD127
Expression Region 21-458
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP) (By similarity).
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Type I cytokine receptor family, Type 4 subfamily
Database Links

KEGG: ecb:100034169

STRING: 9796.ENSECAP00000008818

UniGene: Eca.472

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage
FoxO signaling pathway

Related Products

IL7R Proteins

IL7R Proteins for Equus caballus (Horse)

IL7R ELISA Kit

IL7R ELISA Kit for Equus caballus (Horse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.