Recombinant Human 5-hydroxytryptamine receptor 6 (HTR6)

Code CSB-CF010898HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
HTR6; 5-hydroxytryptamine receptor 6; 5-HT-6; 5-HT6; Serotonin receptor 6
Species
Homo sapiens (Human)
Expression Region
1-440
Target Protein Sequence
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF FNIDPAEPELRPHPLGIPTN
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. It has a high affinity for tricyclic psychotropic drugs. Controls pyramidal neurons migration during corticogenesis, through the regulation of CDK5 activity. Is an activator of TOR signaling.
Gene References into Functions
  1. Serotonin 6 receptor has a role in Alzheimer's disease and depression PMID: 26449188
  2. that HTR6 plays an important role in modulating seizure activity and that the blockade of the 5-HT6 receptor/mTOR pathway could be a potential therapeutic target for epilepsy treatment PMID: 25034463
  3. Studies indicate that serotonin 5-HT6 receptor (5-HT6R) has been proposed as a promising drug target for cognition enhancement in Alzheimer's disease (AD). PMID: 24850589
  4. [review] Controlling the activity of 5-HTR6 receptors seems to provide benefits by alleviating cognitive impairments. PMID: 23844689
  5. Data indicate that hydrogen-bond formation of a methoxy or hydroxy group is not important for binding at the 5-HT6 receptor. PMID: 23542166
  6. The human cloned 5-HT6 receptor is stably transfected in HeLa cells. PMID: 15482912
  7. When expressed in pyramidal neuron progenitors, serotonin receptor 5-HT6 transgene decreases the migration speed of cortical pyramidal neurons, thereby affecting a fundamental step in the assembly of neural circuits. PMID: 22833193
  8. These observations suggest that recruitment of mTOR by prefrontal 5-HT(6) receptors contributes to the perturbed cognition in schizophrenia, offering new vistas for its therapeutic control. PMID: 23027611
  9. There was a statistically significant difference in semantic memory scores among the three genotype groups of T267C in 5-HT6. PMID: 21728060
  10. present findings showed the presence of a higher density of 5-HT(6) receptors, as labeled by [(125)I]SB-258585, in striatum than in hippocampus and prefrontal cortex, and specifically within the neuronal body PMID: 22278721
  11. results indicate that tagging SNPs in HTR6 may not play a role in the pathophysiology of schizophrenia. PMID: 22745941
  12. [review] Since discovery of the 5-HT6 receptor and development of its small-molecule ligands, neurochemical and localization studies have clearly demonstrated its central role in modulating GABAergic neurotransmission across brain structures and networks. PMID: 21329782
  13. detected association between 2 markers (rs6693503 and rs1805054) and three markers (rs6693503, rs1805054 and rs4912138) in HTR6 and METH-induced psychosis respectively. HTR6 may play important role in pathophysiology of METH-induced psychosis in Japanese PMID: 20705401
  14. Common variants in the gene for HT6R do not contribute to obesity. PMID: 21273698
  15. we found no association involving HTR6 polymorphism and mood disorder in the Japanese population PMID: 20394784
  16. Data show that analogues of 5-cyclic amine-3-arylsulfonylindazoles have been identified as high-affinity 5-HT(6) receptor ligands. PMID: 20170099
  17. Jab1 provides a novel signal transduction pathway for 5-HT(6)R and may play an important role in 5-HT(6)R-mediated behavior changes in the brain PMID: 20093369
  18. SNP might have a role in the etiology of suicide in male subjects in the Portuguese population. PMID: 19782122
  19. 5-HT6 receptor gene polymorphism C267T is associated with Parkinson's disease. PMID: 11889255
  20. Association of the 5-hydroxytryptamine(6) receptor gene in Alzheimer's disease. apolipoprotein E epsilon 4 status. the 267C allele of the 5-HT(6) receptor gene may not be a genetic risk factor for AD. PMID: 12023056
  21. significant relationship between 5-HT(6) receptor gene polymorphism (C267T) and self-transcendence PMID: 14698468
  22. These data do not support the idea that the 5-HT(6) receptor gene plays a major role in the etiopathogenesis of schizophrenia. PMID: 15048641
  23. The serotonin type 6 (5-HT(6)) receptor is a G-protein coupled receptor (GPCR) coupled to a stimulatory G-protein (G(S)). PMID: 15737640
  24. In aging control patients, the 5-HT6 receptor was expressed by pyramidal cells and some stellate cells,in layers II-V, and layer I, where a distinct label was observed in neurons and surrounding fibers.In AD patients was significantly decreased by 40%. PMID: 16640790

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in several human brain regions, most prominently in the caudate nucleus.
Database Links

HGNC: 5301

OMIM: 601109

KEGG: hsa:3362

STRING: 9606.ENSP00000289753

UniGene: Hs.22180

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1