Recombinant Human ATPase family AAA domain-containing protein 3A (ATAD3A)

Code CSB-CF878897HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
ATAD3A
Uniprot No.
Alternative Names
ATAD3A; ATPase family AAA domain-containing protein 3A
Species
Homo sapiens (Human)
Expression Region
2-634
Target Protein Sequence
SWLFGINKGPKGEGAGPPPPLPPAQPGAEGGGDRGLGDRPAPKDKWSNFDPTGLERAAKA ARELEHSRYAKDALNLAQMQEQTLQLEQQSKLKMRLEALSLLHTLVWAWSLCRAGAVQTQ ERLSGSASPEQVPAGECCALQEYEAAVEQLKSEQIRAQAEERRKTLSEETRQHQARAQYQ DKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAMRRATVEREMELRHKNEMLRVEAEA RARAKAERENADIIREQIRLKAAEHRQTVLESIRTAGTLFGEGFRAFVTDWDKVTATVAG LTLLAVGVYSAKNATLVAGRFIEARLGKPSLVRETSRITVLEALRHPIQVSRRLLSRPQD ALEGVVLSPSLEARVRDIAIATRNTKKNRSLYRNILMYGPPGTGKTLFAKKLALHSGMDY AIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFVDEADAFLRKRATEKISEDLRATL NAFLYRTGQHSNKFMLVLASNQPEQFDWAINDRINEMVHFDLPGQEERERLVRMYFDKYV LKPATEGKQRLKLAQFDYGRKCSEVARLTEGMSGREIAQLAVSWQATAYASEDGVLTEAM MDTRVQDAVQQHQQKMCWLKAEGPGRGDEPSPS
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential for mitochondrial network organization, mitochondrial metabolism and cell growth at organism and cellular level. May play an important role in mitochondrial protein synthesis. May also participate in mitochondrial DNA replication. May bind to mitochondrial DNA D-loops and contribute to nucleoid stability. Required for enhanced channeling of cholesterol for hormone-dependent steroidogenesis. Involved in mitochondrial-mediated antiviral innate immunity.
Gene References into Functions
  1. ATAD3A region deletions cause cerebellar dysfunction associated with altered mitochondrial DNA and cholesterol metabolism. PMID: 28549128
  2. identification of a recurrent de novo ATAD3A c.1582C>T (p.Arg528Trp) variant by whole-exome sequencing in five unrelated individuals with a core phenotype of global developmental delay, hypotonia, optic atrophy, axonal neuropathy, and hypertrophic cardiomyopathy PMID: 27640307
  3. Mutations in ATAD3A can thus be dominantly inherited and underlie variable neurological phenotypes, including hereditary spastic paraplegia with intrafamiliar variability. This finding extends the group of mitochondrial inner membrane AAA proteins associated with spasticity. PMID: 28158749
  4. stabilization of WASF3 function occurs through its interaction with ATAD3A and GRP78, which may provide a bridge between the ER and mitochondria, allowing communication between the two organelles PMID: 25823022
  5. These results demonstrate that ATAD3-mediated mitochondrial membrane formation participates in the optimal transfer of cholesterol from the endoplasmic reticulum into mitochondria. PMID: 25375035
  6. High ATAD3A expression correlates with radioresistance in glioblastoma. PMID: 24057885
  7. exploring ATAD3 mRNA expression, we confirmed the existence of an alternative splicing in rodent and of several mRNA isoforms in human PMID: 24239551
  8. ATAD3B is a negative regulator of ATAD3A and may function as an adaptor of mitochondrial homeostasis and metabolism in human pluripotent embryonic stem cells and cancer cells. PMID: 22664726
  9. Engineered a high copy strain expressing human ATAD3A-Myc-HIS at a relative high level (2.5mg/l of yeast culture)without significantly affecting yeast growth.Urea-denaturated ATAD3A-Myc-HIS bound to agarose-nickel beads and could be renatured and eluted. PMID: 22542587
  10. ATAD3 may be implicated in an unknown but essential and growth-linked mitochondrial function existing since pluri-cellular organization and involved in tumorigenesis. PMID: 22318359
  11. Results show that HPV infection correlates with increased ATAD3A expression and drug resistance in uterine cervical cancer. PMID: 21743956
  12. ATAD3 may therefore be implicated in an unknown but essential and growth-linked mitochondrial function existing since pluri-cellular -organization and involved in tumorigenesis. PMID: 22192748
  13. silencing of ATAD3A expression reduced PSA secretion and cisplatin resistance, suggesting that ATAD3A was associated with PSA secretion and drug resistance in PCa. PMID: 21584487
  14. gene expression in lung adenocarcinoma correlates with drug resistance and poor prognosis PMID: 20332122
  15. The N-terminal part of ATAD3A is outside the inner mitochondrial membrane and that the C-terminal part is inside the matrix. PMID: 20349121
  16. Data show that ATAD3A is a calcium-dependent S100B target protein in oligodendrocyte progenitor cells and suggest that S100B could assist the newly synthesized ATAD3A protein in proper folding and subcellular localization. PMID: 20351179
  17. Data show that the mitochondrial AAA(+) ATPase protein ATAD3A is involved in dynamic interactions between components of the outer and inner mitochondrial membranes which control a number of critical mitochondrial functions. PMID: 20154147
  18. Results suggest that mitochondrial DNA displacement loops serve to recruit ATAD3 protein for the purpose of forming or segregating mitochondrial nucleoids. PMID: 17210950
  19. We also have shown that the loss of ATAD 3A/3B may be involved in the transformation pathway and the chemosensitivity of oligodendrogliomas. PMID: 18639545

Show More

Hide All

Involvement in disease
Harel-Yoon syndrome (HAYOS)
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion matrix, mitochondrion nucleoid.
Protein Families
AAA ATPase family
Tissue Specificity
Overexpressed in lung adenocarcinomas (at protein level).
Database Links

HGNC: 25567

OMIM: 612316

KEGG: hsa:55210

STRING: 9606.ENSP00000368030

UniGene: Hs.23413

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×