Recombinant Human Alpha-1D adrenergic receptor (ADRA1D)

Code CSB-CF001387HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
ADRA1D; ADRA1A; Alpha-1D adrenergic receptor; Alpha-1A adrenergic receptor; Alpha-1D adrenoreceptor; Alpha-1D adrenoceptor; Alpha-adrenergic receptor 1a
Species
Homo sapiens (Human)
Expression Region
1-572
Target Protein Sequence
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE AVSLGVPHEVAEGATCQAYELADYSNLRETDI
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This alpha-adrenergic receptor mediates its effect through the influx of extracellular calcium.
Gene References into Functions
  1. Hetero-oligomerization of a1B/D-adrenergic receptor with the chemokine (C-X-C motif) receptor 4:atypical chemokine receptor 3 heteromeric complex is required for a1B/Dadrenergic receptor function. PMID: 28862946
  2. processing of the ADRA1D NT domain is a physiological mechanism employed by cells to generate a functional ADRA1D isoform with optimal pharmacodynamic properties. PMID: 27382054
  3. expression of carboxyl terminus-truncated alpha1D-adrenoceptors alters ERK and p38 phosphorylation state. PMID: 27146292
  4. Immunoreactivity for ADRA2D was densely distributed in submucosal glands of nasal turbinates. PMID: 26739946
  5. In conclusion, our work clarified some cellular aspects promoted by alpha1D-AR activity modulation and supports a further pharmacological approach in the cure of hormone-refractory PC, by targeting specifically this AR subtype PMID: 26621245
  6. This study showed that ADRA1D gene involved in neuronal growth and cerebellum development and associated with neurological and psychological disorders. PMID: 26381449
  7. alpha1A-adrenergic receptors are stably expressed and stimulate cell migration and TGF-beta1, IGF-1, hyaluronan and PIP production in human skin fibroblasts. PMID: 24844469
  8. Cross-talk between alpha1D-adrenoceptors and transient receptor potential vanilloid type 1 triggers prostate cancer cell proliferation. PMID: 25481381
  9. Mean alpha-receptor stain rates in renal pelvis were 2.65 +/- 0.74, 1.35 +/- 0.81 and 2.9 +/- 0.30 for alpha 1A, 1B and 1D, respectively. For calyces, the rates are 2.40 +/- 0.82, 1.50 +/- 0.76 and 2.75 +/- 0.44 for alpha 1A, 1B and 1D, respectively. PMID: 23877383
  10. alpha(1)(D)-adrenoceptors in the lower urinary tract might play an important role in the pathophysiology of lower urinary tract disorders. [review] PMID: 23205498
  11. Data show that alpha-dystrobrevin-1 recruits alpha-catulin, which supersensitizes alpha(1D)-AR functional responses by recruiting effector molecules to the signalosome. PMID: 21115837
  12. Genetic characteristics associated with response to domperidone therapy included polymorphisms in the drug transporter gene ABCB1, the potassium channel KCNH2 gene, and alpha1D--adrenoceptor ADRA1D gene. PMID: 21063774
  13. Data show thah activation of alpha(1)A- or alpha(1)B-adrenergic receptors inhibits serum-promoted cell proliferation, whereas alpha(1)D-AR activation does not show such an inhibitory effect. PMID: 12409310
  14. These studies suggest that gC1qR interacts specifically with alpha1B- and alpha1D-, but not alpha1A-ARs, and this interaction depends on the presence of an intact C-tail. PMID: 14626446
  15. cell surface expression of alpha1D-adrenergic receptors is controlled by heterodimerization with alpha1B-adrenergic receptors PMID: 14736874
  16. alpha(1A)- and alpha(1D)-adrenergic receptors mediate G(1)-S cell-cycle arrest PMID: 15297446
  17. Human ureter was endowed with each alpha1 AR subtype, although alpha1D and alpha1A ARs were prevalent over alpha1B ARs. PMID: 15690361
  18. alpha1D-adrenergic receptors are regulated by syntrophins through a PDZ domain-mediated interaction PMID: 16533813
  19. Differential methylation of proximal GC boxes in the ADRA1D promoter disrupts Sp1 binding in a cell-specific manner resulting in repression of basal alpha1dAR expression. PMID: 17384146
  20. ADRA1D polymorphisms are predictive markers of the response to beta-blockers PMID: 17404580
  21. Stimulation of alpha(1D)-ARs by picomolar phenylephrine concentrations devoid of any contractile vascular effects, induces a proangiogenic phenotype in endothelial cells that is enhanced in a hypoxic environment. PMID: 17660397
  22. In the proximal and medial ureter, the distribution of ARs was alpha 1d > or = alpha 1a > alpha 1b; In the distal ureter, the distribution of ARs was alpha 1d > alpha 1a > alpha 1b PMID: 17681068
  23. expression in distal ureter higher than in proximal and mid ureter but not statistically significant PMID: 17973108
  24. Investigate role of ADRA1D amino residues in binding of beta-adrenergic antagonists (prazosin/tamulosin). PMID: 18187928
  25. ADRA1A expression was decreased in end stage renal disease. Functional receptor changes mediated vascular hypersensitivity to phenylephrine. PMID: 18257748
  26. ADRA1D induces vascular smooth muscle apoptosis via a p53-dependent mechanism. PMID: 18628404
  27. Our data indicate that carboxyl terminus-truncated alpha(1D)-adrenoceptors are fully functional and subjected to regulation by phosphorylation. The roles of the carboxyl termini differ among alpha(1)-adrenoceptor subtypes. PMID: 19458937

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA1D sub-subfamily
Database Links

HGNC: 280

OMIM: 104219

KEGG: hsa:146

STRING: 9606.ENSP00000368766

UniGene: Hs.557

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1