Recombinant Human Beta-1,3-N-acetylglucosaminyltransferase manic fringe(MFNG)

Code CSB-CF013757HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O00587
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR
Source in vitro E.coli expression system
Gene Names MFNG
Protein Names Recommended name: Beta-1,3-N-acetylglucosaminyltransferase manic fringe EC= 2.4.1.222 Alternative name(s): O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Expression Region 1-321
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Glycosyltransferase that initiates the elongation of O-linked fucose residues attached to EGF-like repeats in the extracellular domain of Notch molecules
Subcellular Location Golgi apparatus membrane, Single-pass type II membrane protein
Protein Families Glycosyltransferase 31 family
Database Links

HGNC: 7038

OMIM: 602577

KEGG: hsa:4242

STRING: 9606.ENSP00000349490

UniGene: Hs.517603

Pathway Notch signaling pathway

Related Products

MFNG Antibodies

MFNG Antibodies for Homo sapiens (Human)

MFNG Proteins

MFNG Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.